Protein Information

General Information
MoonProt ID265
First appeared in release1.0
Name(s)Vacuolar protein-sorting-associated protein 25 ESCRT-II complex subunit VPS25 Vacuolar protein sorting 25 Gene Name: Vps25
UniProt IDQ7JXV9 (VPS25_DROME), Reviewed
GO termsGO:0000046 autophagic vacuole fusion GO:0006810 transport GO:0008283 cell proliferation GO:0008593 regulation of Notch signaling pathway GO:0010669 epithelial structure maintenance GO:0015031 protein transport GO:0016197 endosomal transport GO:0030154 cell differentiation GO:0032509 endosome transport via multivesicular body sorting pathway GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway GO:0042981 regulation of apoptotic process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway GO:0045199 maintenance of epithelial cell apical/basal polarity GO:0048803 imaginal disc-derived male genitalia morphogenesis GO:0050680 negative regulation of epithelial cell proliferation GO:0000814 ESCRT II complex GO:0005737 cytoplasm GO:0005768 endosome GO:0010008 endosome membrane GO:0016020 membrane GO:0036452 ESCRT complex GO:0003729 mRNA binding GO:0003730 mRNA 3-UTR binding
Organisms for which functions have been demonstratedDrosophila melanogaster
Sequence length174
FASTA sequence>sp|Q7JXV9|VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster GN=Vps25 PE=2 SV=1 MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionComponent of the ESCRT-II complex (ensodomal sorting complex required for transport II) complex needed for sorting ubiquitinated endosomal proteins into multivesicular bodies important for transport of transmembrane proteins to the lysosome for degradation
References for functionHerz, Hans-Martin, et al. "Common and distinct genetic properties of ESCRT-II components in Drosophila." PLoS One 4.1 (2009): e4165.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, endosomal membrane
Comments
Function 2
Function descriptionwith other members of the ESCRT complex, binds to the localization element in the 3' untranslated region (UTR) of bicoid mRNA functions in localizing bicoid mRNA to the anterior of the Drosophila egg
References for functionIrion U, St Johnston. bicoid RNA localization requires specific binding of an endosomal sorting complex. Nature. 2007 Feb 1. PMID: 17268469
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments