Protein Information

General Information
MoonProt ID27
First appeared in release1.0
Name(s)enolase 2-phospho-D-glycerate hydro-lyase 2-phosphoglycerate dehydratase Gene Name: eno
UniProt IDB7J1R2 (ENO_BORBZ), Reviewed
GO termsGO:0006096 glycolysis GO:0000287 magnesium ion binding GO:0004634 phosphopyruvate hydratase activity GO:0016829 lyase activity GO:0016829 lyase activity GO:0046872 metal ion binding GO:0000015 phosphopyruvate hydratase complex GO:0005576 extracellular region GO:0005737 cytoplasm GO:0009986 cell surface GO: 0005515 protein binding
Organisms for which functions have been demonstratedBorrelia burgdorferi
Sequence length433
FASTA sequence>sp|B7J1R2|ENO_BORBZ Enolase OS=Borrelia burgdorferi (strain ZS7) GN=eno PE=3 SV=1 MGFHIYEIKARQIIDSRGNPTVEADVILEDGTYGRAAVPSGASTGINEAVELRDGDKSVYMGKGVLKAIENIKNIIAPELEGMSALNQVAIDRKMLELDGTPTKEKLGANAILAVSMATAKAAAKYLGLRPYQYLGAYKANILPTPMCNIINGGAHSDNSVDFQEFMIMPIGAKTFSEAIRMAAEVFHTLKGILSGKGYATSVGDEGGFAPNLKSNEEACEVIIEAIKKAGYEPGKDIAIALDPATSELYDPKTKKYVLKWSTKEELTSEQMVEYWAKWVEKYPIISIEDGMAEEDWDGWKKLTDKIGNKIQLVGDDLFVTNTSFLKKGIEMGVANSILIKVNQIGTLTETFEAVEMAKKAGYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRTDRIAKYNQLIRIEEELETTAEYHGKSVFYSIKQK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionenolase, enzyme 2-phospho-D-glycerate => phosphoenolpyruvate + H2O reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis
References for functionBurgdorfer, Willy, et al. "Lyme disease-a tick-borne spirochetosis?." Science 216.4552 (1982): 1317-1319.
E.C. number4.2.1.11
Location of functional site(s)Active site:206,341 Binding site:316,156,165,341,392,289 Metal binding site:243,289,316
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding (binds human plasminogen)
References for functionFloden AM, Watt JA, Brissette CA (2011) Borrelia burgdorferi Enolase Is a Surface-Exposed Plasminogen Binding Protein. PLoS One. 2011;6(11):e27502. doi: 10.1371/journal.pone.0027502. Epub 2011 Nov 8.PMID:22087329
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments