Protein Information

General Information
MoonProt ID275
First appeared in release1.0
Name(s)Gpx4 Phospholipid hydroperoxide glutathione peroxidase, mitochondrial PHGPx Glutathione peroxidase 4 GPx-4 GSHPx-4 Gene Name:GPX4
UniProt IDP36969 (GPX4_HUMAN), Reviewed
GO termsGO:0006325 chromatin organization GO:0006644 phospholipid metabolic process GO:0006749 glutathione metabolic process GO:0006979 response to oxidative stress GO:0007275 multicellular organismal development GO:0007283 spermatogenesis GO:0007568 aging GO:0019369 arachidonic acid metabolic process GO:0019372 lipoxygenase pathway GO:0032355 response to estradiol GO:0042744 hydrogen peroxide catabolic process GO:0044281 small molecule metabolic process GO:0050727 regulation of inflammatory response GO:0055114 oxidation-reduction process GO:0004601 peroxidase activity GO:0004602 glutathione peroxidase activity GO:0008430 selenium binding GO:0016491 oxidoreductase activity GO:0043295 glutathione binding GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity GO:0005634 nucleus GO:0005635 nuclear envelope GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005743 mitochondrial inner membrane GO:0005829 cytosol GO:0070062 extracellular vesicular exosome GO:0097223 sperm part
Organisms for which functions have been demonstratedHomo sapiens
Sequence length197
FASTA sequence>sp|P36969|GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Homo sapiens GN=GPX4 PE=1 SV=3 MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Structure Information
PDB ID2OBI, 3GS3
Quaternary structure
Function 1
Function descriptionPhospholipid hydroperoxide glutathione peroxidase, enzyme removes membrane lipid peroxidation, cell protection 2 glutathione + a lipid hydroperoxide => glutathione disulfide + lipid + 2 H2O
References for functionKelner, Michael J., and Mark A. Montoya. "Structural organization of the human selenium-dependent phospholipid hydroperoxide glutathione peroxidase gene (GPX4): chromosomal localization to 19p13. 3." Biochemical and biophysical research communications249.1 (1998): 53-55.
E.C. number1.11.1.12
Location of functional site(s)active site: 73
Cellular location of functionmitochondrion
Comments
Function 2
Function descriptionstructural role in capsule in mature spermatozoa
References for functionScheerer P, Borchert A, Krauss N, Wessner H, Gerth C, H?hne W, Kuhn H. Structural basis for catalytic activity and enzyme polymerization of phospholipid hydroperoxide glutathione peroxidase-4 (GPx4). Biochemistry. 2007 Aug 7;46(31):9041-9. PMID: 17630701
E.C. numberN/A
Location of functional site(s)
Cellular location of functionspermatozoa capsule
Comments