Protein Information

General Information
MoonProt ID276
First appeared in release1.0
Name(s)Lactose synthetase Beta-1,4-galactosyltransferase 1 Beta-1,4-GalTase 1 Beta4Gal-T1 b4Gal-T1 UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1 Lactose synthase A protein N-acetyllactosamine synthase Nal synthase Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase Gene Name: B4GALT1
UniProt IDP08037 (B4GT1_BOVIN), Reviewed
GO termsGO:0002064 epithelial cell development GO:0002526 acute inflammatory response GO:0005975 carbohydrate metabolic process GO:0005989 lactose biosynthetic process GO:0006012 galactose metabolic process GO:0006486 protein glycosylation GO:0006487 protein N-linked glycosylation GO:0007155 cell adhesion GO:0007339 binding of sperm to zona pellucida GO:0007341 penetration of zona pellucida GO:0008285 negative regulation of cell proliferation GO:0009101 glycoprotein biosynthetic process GO:0009312 oligosaccharide biosynthetic process GO:0030198 extracellular matrix organization GO:0030879 mammary gland development GO:0042060 wound healing GO:0042127 regulation of cell proliferation GO:0043065 positive regulation of apoptotic process GO:0045136 development of secondary sexual characteristics GO:0048754 branching morphogenesis of an epithelial tube GO:0050900 leukocyte migration GO:0051270 regulation of cellular component movement GO:0060046 regulation of acrosome reaction GO:0060054 positive regulation of epithelial cell proliferation involved in wound healing GO:0060055 angiogenesis involved in wound healing GO:0060058 positive regulation of apoptotic process involved in mammary gland involution GO:0003831 beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity GO:0003945 N-acetyllactosamine synthase activity GO:0004461 lactose synthase activity GO:0005515 protein binding GO:0008092 cytoskeletal protein binding GO:0008378 galactosyltransferase activity GO:0016740 transferase activity GO:0016757 transferase activity, transferring glycosyl groups GO:0030145 manganese ion binding GO:0035250 UDP-galactosyltransferase activity GO:0042803 protein homodimerization activity GO:0043014 alpha-tubulin binding GO:0046872 metal ion binding GO:0048487 beta-tubulin binding GO:0000138 Golgi trans cisterna GO:0005576 extracellular region GO:0005794 Golgi apparatus GO:0005886 plasma membrane GO:0009897 external side of plasma membrane GO:0009986 cell surface GO:0016020 membrane GO:0016021 integral component of membrane GO:0016323 basolateral plasma membrane GO:0030057 desmosome GO:0030112 glycocalyx GO:0031526 brush border membrane GO:0032580 Golgi cisterna membrane GO:00016757 transferase activity, transferring glycosyl groups GO:0005975 carbohydrate metabolic process GO:0016740 transferase activity
Organisms for which functions have been demonstratedBos taurus
Sequence length402
FASTA sequence>sp|P08037|B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus GN=B4GALT1 PE=1 SV=3 MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPLQGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTSAPVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Structure Information
PDB ID1FR8, 1FGX, 1NF5, 1NKH, 1NQI, 1NWG, 1O23, 1OQM, 1NMM, 1O0R, 1YRO, 1TVY, 1TW1, 1TW5, 2FYC, 4KRV, 1PZY, 1PZT, 2FYD, 1NHE
Quaternary structure
Function 1
Function descriptionLactose synthetase, enzyme UDP-alpha-D-galactose + D-glucose => UDP + lactose
References for function
E.C. number2.4.1.22
Location of functional site(s)metal binding: 254, 347; binding site: 314, 359
Cellular location of functionGolgi apparatus
Comments
Function 2
Function descriptionUDP-galactose: N-acetylglucosamine galactosyltransferase, enzyme UDP-alpha-D-galactose + N-acetyl-D-glucosamine => UDP + N-acetyllactosamine
References for functionBrew K, Vanaman TC, Hill RL. The role of alpha-lactalbumin and the A protein in lactose synthetase: a unique mechanism for the control of a biological reaction. Proc Natl Acad Sci U S A. 1968 Feb;59(2):491-7. PMID: 5238979
E.C. number2.4.1.90
Location of functional site(s)
Cellular location of functionGolgi apparatus
Comments