Protein Information

General Information
MoonProt ID278
First appeared in release1.0
Name(s)Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial NAD(+)-specific ICDH Gene Name: IDH2
UniProt IDP28241 (IDH2_YEAST), Reviewed
GO termsGO:0006099 tricarboxylic acid cycle GO:0006102 isocitrate metabolic process GO:0006537 glutamate biosynthetic process GO:0008152 metabolic process GO:0055114 oxidation-reduction process GO:0000287 magnesium ion binding GO:0003723 RNA binding GO:0003824 catalytic activity GO:0004449 isocitrate dehydrogenase (NAD+) activity GO:0005515 protein binding GO:0016491 oxidoreductase activity GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0046872 metal ion binding GO:0051287 NAD binding GO:0004449 isocitrate dehydrogenase (NAD+) activity GO:0005739 mitochondrion GO:0005759 mitochondrial matrix GO:0005962 mitochondrial isocitrate dehydrogenase complex (NAD+)
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length369
FASTA sequence>sp|P28241|IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH2 PE=1 SV=1 MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL
Structure Information
PDB ID3BLW, 3BLX, 3BLV
Quaternary structure
Function 1
Function descriptionIsocitrate dehydrogenase, enzyme Isocitrate + NAD+ = 2-oxoglutarate + CO2 + NADH Citric acid cycle
References for functionCupp, Jill R., and L. McAlister-Henn. "Cloning and characterization of the gene encoding the IDH1 subunit of NAD (+)-dependent isocitrate dehydrogenase from Saccharomyces cerevisiae." Journal of Biological Chemistry 267.23 (1992): 16417-16423.
E.C. number1.1.1.41
Location of functional site(s)binding site: 119, 129, 150, 237; site: 157, 204; metal binding: 237, 263, 267
Cellular location of functionmitochondrion
Comments
Function 2
Function descriptionbinds mRNA binds specifically to 5'-untranslated leaders of mitochondrial mRNAs
References for functionElzinga SD, Bednarz AL, van Oosterum, Dekker PJ, Grivell LA. Yeast mitochondrial NAD(+)-dependent isocitrate dehydrogenase is an RNA-binding protein. Nucleic Acids Res. 1993 Nov 25. PMID: 7505425
E.C. numberN/A
Location of functional site(s)
Cellular location of functionmitochondrion
Comments