Protein Information

General Information
MoonProt ID279
First appeared in release1.0
Name(s)Germin Oxalate oxidase 1
UniProt IDP45850 (OXO1_HORVU), Reviewed
GO termsGO:0006950 response to stress GO:0055114 oxidation-reduction process GO:0016491 oxidoreductase activity GO:0030145 manganese ion binding GO:0045735 nutrient reservoir activity GO:0046872 metal ion binding GO:0050162 oxalate oxidase activity GO:0005576 extracellular region GO:0005618 cell wall GO:0048046 apoplast GO:0004784 superoxide dismutase activity
Organisms for which functions have been demonstratedHordeum vulgare
Sequence length201
FASTA sequence>1FI2:A|PDBID|CHAIN|SEQUENCE TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Structure Information
PDB ID1FI2
Quaternary structure
Function 1
Function descriptionOxalate oxidase, enzyme Oxalate + O2 + 2 H+ => 2 CO2 + H2O2
References for functionWoo, Eui-Jeon, et al. "Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities." Nature Structural & Molecular Biology 7.11 (2000): 1036.
E.C. number1.2.3.4
Location of functional site(s)metal binding: 88, 90, 95, 137
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionsuperoxide dismutase, enzyme 2 superoxide (O2-) + 2 H(+) <=> O(2) + H(2)O(2)
References for functionWoo EJ, Dunwell JM, Goodenough PW, Marvier AC, Pickersgill RW. Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities. Nat Struct Biol. 2000 Nov;7(11):1036-40. PMID: 11062559
E.C. number1.15.1.1
Location of functional site(s)
Cellular location of functioncytoplasm
Comments