Protein Information

General Information
MoonProt ID280
First appeared in release1.0
Name(s)30S ribosomal protein S10 Gene Name:rpsJ
UniProt IDP0A7R5 (RS10_ECOLI), Reviewed
GO termsGO:0006412 translation GO:0000049 tRNA binding GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0005515 protein binding GO:0005622 intracellular GO:0005840 ribosome GO:0022627 cytosolic small ribosomal subunit GO:0030529 ribonucleoprotein complex GO:0031564 transcription antitermination
Organisms for which functions have been demonstratedEscherichia coli
Sequence length103
FASTA sequence>sp|P0A7R5|RS10_ECOLI 30S ribosomal protein S10 OS=Escherichia coli (strain K12) GN=rpsJ PE=1 SV=1 MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Structure Information
PDB ID1P87, 2AVY, 2AW7, 1VS5, 1VS7, 2I2P, 2I2U, 2QOU, 2QOW, 2QOY, 2QP0, 2QAL, 2QAN, 2QB9, 2QBB, 1P6G, 2WWL, 2OFO, 2OFP, 2OFA, 2OFB, 2OFX, 2OFY, 2OAQ, 3OAR, 2YKR, 4A2I, 3J18, 4GD1, 4GD2, 3FIH, 3J4W, 3J4Y, 3J4Z, 3J53, 3J55, 3J57, 3J59, 3J5B, 3J5D, 3J5F, 3J5H
Quaternary structure
Function 1
Function descriptionribosomal protein part of the 30S subunit
References for functionYaguchi, Makoto, Camille Roy, and H. G. Wittmann. "The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli." FEBS letters 121.1 (1980): 113-116.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptionpart of an antitermination apparatus antitermination of Rho-dependent and Rho-independent terminators
References for functionDas A, Ghosh B, Barik S, Wolska K. Evidence that ribosomal protein S10 itself is a cellular component necessary for transcription antitermination by phage lambda N protein. Proc Natl Acad Sci U S A. 1985 Jun;82(12):4070-4. PMID: 2987961
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments