Protein Information

General Information
MoonProt ID283
First appeared in release1.0
Name(s)50S ribosomal protein L10 Gene Name: rplJ
UniProt IDP0A7J3
GO termsGO:0006412 translation GO:0042254 ribosome biogenesis GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0019843 rRNA binding GO:0070180 LSU rRNA binding GO:0005622 intracellular GO:0005840 ribosome GO:0030529 ribonucleoprotein complex GO:0006412 translation
Organisms for which functions have been demonstratedEscherichia coli
Sequence length165 aa
FASTA sequence>sp|P0A7J3|RL10_ECOLI 50S ribosomal protein L10 OS=Escherichia coli (strain K12) GN=rplJ PE=1 SV=2 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Structure Information
PDB ID3UOS, 4KIX, 4KIZ, 4KJ1, 4KJ5, 4KJ9, 3J5O, 3J5U, 3J5W, 2SGF, 2J0W, 3J0Y, 3J11, 3J12, 3J14, 3J37, 3J0T
Quaternary structure
Function 1
Function descriptionribosomal protein part of the 50S subunit
References for functionPost, Leonard E., et al. "Nucleotide sequence of the ribosomal protein gene cluster adjacent to the gene for RNA polymerase subunit beta in Escherichia coli." Proceedings of the National Academy of Sciences 76.4 (1979): 1697-1701.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptiontranslation inhibitor autogenous regulation of translation
References for functionBrot N, Caldwell P, Weissbach H. Autogenous control of Escherichia coli ribosomal protein L10 synthesis in vitro. Proc Natl Acad Sci U S A. 1980 May. PMID: 6994102
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments