Protein Information

General Information
MoonProt ID286
First appeared in release1.0
Name(s)Matrix metaloproteinase 12 Macrophage metalloelastase MME MMP-12 Gene Name:Mmp12
UniProt IDP34960 (MMP12_MOUSE), Reviewed
GO termsGO:0006508 proteolysis GO:0042060 wound healing GO:0004222 metalloendopeptidase activity GO:0005509 calcium ion binding GO:0008233 peptidase activity GO:0008237 metallopeptidase activity GO:0008270 zinc ion binding GO:0016787 hydrolase activity GO:0046872 metal ion binding GO:0005576 extracellular region GO:0005578 proteinaceous extracellular matrix GO:0031012 extracellular matrix GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedMus musculus
Sequence length473
FASTA sequence>sp|P34960|MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus GN=Mmp12 PE=1 SV=3 MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionMatrix metaloproteinase, enzyme cleaves elastin, IFN-?
References for functionMarchant DJ, Bellac CL, Moraes TJ, Wadsworth SJ, Dufour A, Butler GS, Bilawchuk LM, Hendry RG, Robertson AG, Cheung CT, Ng J, Ang L, Luo Z, Heilbron K, Norris MJ, Duan W, Bucyk T, Karpov A, Devel L, Georgiadis D, Hegele RG, Luo H, Granville DJ, Dive V, McManus BM, Overall CM. A new transcriptional role for matrix metalloproteinase-12 in antiviral immunity. Nat Med. 2014 May;20(5):493-502. doi: 10.1038/nm.3508. PMID: 24784232
E.C. number3.4.24.65
Location of functional site(s)metal binding: 96, 128, 162, 172, 174, 179, 180, 182, 184, 187, 194, 198, 200, 202, 203, 205, 222, 226, 232, 293, 385, 434; active site: 223
Cellular location of functionextracellular
Comments
Function 2
Function descriptionpromotes transcription binds to the NFKBIA promoter
References for functionMarchant DJ, Bellac CL, Moraes TJ, Wadsworth SJ, Dufour A, Butler GS, Bilawchuk LM, Hendry RG, Robertson AG, Cheung CT, Ng J, Ang L, Luo Z, Heilbron K, Norris MJ, Duan W, Bucyk T, Karpov A, Devel L, Georgiadis D, Hegele RG, Luo H, Granville DJ, Dive V, McManus BM, Overall CM. A new transcriptional role for matrix metalloproteinase-12 in antiviral immunity. Nat Med. 2014 May;20(5):493-502. doi: 10.1038/nm.3508. PMID: 24784232
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments