Protein Information

General Information
MoonProt ID287
First appeared in release1.0
Name(s)dCTP deaminase, dUMP-forming Bifunctional deaminase/diphosphatase MjDCD-DUT DCD/DUT Gene Name:dcd
UniProt IDQ57872 (DCD_METJA), Reviewed
GO termsGO:0006226 dUMP biosynthetic process GO:0006229 dUTP biosynthetic process GO:0009117 nucleotide metabolic process GO:0009220 pyrimidine ribonucleotide biosynthetic process GO:0046080 dUTP metabolic process GO:0008829 dCTP deaminase activity GO:0016787 hydrolase activity GO:0033973 dCTP deaminase (dUMP-forming) activity GO:0046080 dUTP metabolic process GO:0016787 hydrolase activity
Organisms for which functions have been demonstratedMethanocaldococcus jannaschii
Sequence length204
FASTA sequence>sp|Q57872|DCD_METJA dCTP deaminase, dUMP-forming OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dcd PE=1 SV=1 MILSDKDIIDYVTSKRIIIKPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIKIKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTTNEYIELPNDISAQYQGRSSLGRVFLTSHQTAGWIDAGFKGKITLEIVAFDKPVILYKNQRIGQLIFSKLLSPADVGYSERKTSKYAYQKSVMPSLIHLDNHKKD
Structure Information
PDB ID1OGH, 1PKH, 1PKJ, 1PKK, 2HXB, E145, 3GF0, 2HXD
Quaternary structure
Function 1
Function descriptiondCTP deaminase deamination of the cytosine moiety in dCTP dCTP + 2 H2O => dUMP + diphosphate + NH3 Pyrimidine metabolism, dUMP biosynthesis
References for functionLi, Hong, et al. "The Methanococcus jannaschii dCTP deaminase is a bifunctional deaminase and diphosphatase." Journal of Biological Chemistry 278.13 (2003): 11100-11106.
E.C. number3.5.4.13
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionhydrolysis of the triphosphate moiety forming dUMP dUTP => dUMP
References for functionJohansson E, Bjornberg O, Nyman PO, Larsen S. Structure of the bifunctional dCTP deaminase-dUTPase from Methanocaldococcus jannaschii and its relation to other homotrimeric dUTPases. J Biol Chem. 2003 Jul 25;278(30):27916-22. PMID: 12756253
E.C. number3.6.1.23
Location of functional site(s)
Cellular location of functioncytoplasm
Comments