Protein Information

General Information
MoonProt ID288
First appeared in release1.0
Name(s)Penicillin binding protein 4 D-alanyl-D-alanine carboxypeptidase DacB DD-carboxypeptidase DD-peptidase D-alanyl-D-alanine endopeptidase DD-endopeptidase Penicillin-binding protein 4 PBP-4 Gene Name: dacB
UniProt IDP24228 (DACB_ECOLI), Reviewed
GO termsGO:0000270 peptidoglycan metabolic process GO:0006508 proteolysis GO:0007049 cell cycle GO:0008360 regulation of cell shape GO:0009252 peptidoglycan biosynthetic process GO:0009253 peptidoglycan catabolic process GO:0009254 peptidoglycan turnover GO:0016998 cell wall macromolecule catabolic process GO:0043093 cytokinesis by binary fission GO:0046677 response to antibiotic GO:0051301 cell division GO:0071555 cell wall organization GO:0004175 endopeptidase activity GO:0004180 carboxypeptidase activity GO:0004185 serine-type carboxypeptidase activity GO:0005515 protein binding GO:0008658 penicillin binding GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity GO:0016787 hydrolase activity GO:0030288 outer membrane-bounded periplasmic space GO:0042597 periplasmic space GO:0004175 endopeptidase activity
Organisms for which functions have been demonstratedEscherichia coli
Sequence length477
FASTA sequence>sp|P24228|DACB_ECOLI D-alanyl-D-alanine carboxypeptidase DacB OS=Escherichia coli (strain K12) GN=dacB PE=1 SV=2 MRFSRFIIGLTSCIAFSVQAANVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKDELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Structure Information
PDB ID2EX2, 2EX6, 2EX8, 2EX9, 2EXA,
E.C. number3.4.16.4
Location of functional site(s)active site: 62, 65, 306; binding site: 417
Cellular location of functionperiplasm
Comments
Function 2
Function descriptionendopeptidase, enzyme
References for functionKishida H, Unzai S, Roper DI, Lloyd A, Park SY, Tame JR. Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics. Biochemistry. 2006 Jan 24;45(3):783-92. PMID: 16411754
E.C. number3.4.21.-
Location of functional site(s)
Cellular location of functionperiplasm
Comments