Protein Information

General Information
MoonProt ID306
First appeared in release2.0
Name(s)fructose bisphosphate aldolase (FBA), fructose-bisphosphate aldolase, fructose 1,6-bisphosphate aldolase, Gene: fba
UniProt IDP0A4S2 (ALF_STRR6)
GO termsGO:0005975 carbohydrate metabolic process GO:0006096 glycolytic process GO:0030388 fructose 1,6-bisphosphate metabolic process GO:0003824 catalytic activity GO:0004332 fructose-bisphosphate aldolase activity GO:0008270 zinc ion binding GO:0016829 lyase activity GO:0016832 aldehyde-lyase activity GO:0046872 metal ion binding GO:0005515 protein binding GO:0098631 cell adhesion mediator activity
Organisms for which functions have been demonstratedStreptococcus pneumoniae
Sequence length293 amino acids
FASTA sequence>sp|P0A4S2|ALF_STRR6 Fructose-bisphosphate aldolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fba PE=1 SV=1 MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA
Structure Information
PDB IDnon, but structures available of some homologues
Quaternary structure
Function 1
Function descriptionfructose bisphosphate aldolase, enzyme, in glycolysis and gluconeogenesis, D-fructose 1,6-bisphosphate -> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate
References for functionJado I., Fenoll A., Cepeda T., Casal J., Perez A. Cloning, sequencing, and chromosomal location of a putative class-II aldolase gene from Streptococcus pneumoniae. Curr. Microbiol. 39:31-36(1999) PMID: 10387114
E.C. number4.1.2.13
Location of functional site(s)binding site: 50, 179; active site: 85; metal binding: 86, 106, 136, 178, 208
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionadhesin, binds to receptor on host cells, binds to host Flamingo cadherin receptor (FCR)
References for functionBlau K, Portnoi M, Shagan M, Kaganovich A, Rom S, Kafka D, Chalifa Caspi V, Porgador A, Givon-Lavi N, Gershoni JM, Dagan R, Mizrachi Nebenzahl Y. Flamingo cadherin: a putative host receptor for Streptococcus pneumoniae. J Infect Dis. 2007 Jun 15;195(12):1828-37. PMID: 17492599
E.C. number
Location of functional site(s)
Cellular location of functioncell wall
Comments