Protein Information

General Information
MoonProt ID308
First appeared in release2.0
Name(s)alpha-ketoglutarate dehydrogenase E2, dihydrolipoyl succinyltransferase, alpha-KDE2, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative Gene: Tb11.01.3550
UniProt IDQ383B2 (Q383B2_TRYB2)
GO termsGO:0008152 metabolic process GO:0004149 dihydrolipoyllysine-residue succinyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups GO:0005739 mitochondrion GO:0033955 mitochondrial DNA inheritance
Organisms for which functions have been demonstratedTrypanosoma brucei
Sequence length383 amino acids
FASTA sequence>tr|Q383B2|Q383B2_TRYB2 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.3550 PE=3 SV=1 MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIICQIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAPAAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLTTFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEYHDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTISNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARIVLDLA
Structure Information
PDB IDnone, closes homologue is 54% identical
Quaternary structurepart of large complex with E1 and E3
Function 1
Function descriptionalpha-ketoglutarate dehydrogenase E2, in Krebs cycle, dihydrolipoyl succinyltransferase
References for functionVan de Water, Judy, et al. "Molecular mimicry and primary biliary cirrhosis: premises not promises." Hepatology 33.4 (2001): 771-775.
E.C. number2.3.1.61
Location of functional site(s)binding site: 250, 255, 324, 326
Cellular location of functionmitochondrial matrix and inner membrane
CommentsKrebs cycle not functional in bloodstream form of parasite, used only for other function there
Function 2
Function descriptionmitochondrial DNA inheritance
References for functionSykes SE, Hajduk SL.Dual functions of alpha-ketoglutarate dehydrogenase E2 in the Krebs cycle and mitochondrial DNA inheritance in Trypanosoma brucei. Eukaryot Cell. 2013 Jan;12(1):78-90. doi: 10.1128/EC.00269-12. PMID: 23125353
E.C. number
Location of functional site(s)
Cellular location of functionbinds kinetoplast DNA
Comments