Protein Information

General Information
MoonProt ID315
First appeared in release2.0
Name(s)chloroplast dihydrolipoamide acetyltransferase (DLA, E2), DLA2 pyruvate dehydrogenase complex subunit in chloroplast Gene: DLA2
UniProt IDA8J7F6 (A8J7F6_CHLRE)
GO termsGO:0008152 metabolic process GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups
Organisms for which functions have been demonstratedChlamydomonas reinhardtii (unicellular green alga)(Chlamydomonas smithii)
Sequence length405 amino acids
FASTA sequence>tr|A8J7F6|A8J7F6_CHLRE Dihydrolipoamide acetyltransferase OS=Chlamydomonas reinhardtii GN=DLA2 PE=3 SV=1 MQATTRVPAKSGVSSSAKRVAASGRRVLVVPNAVKDVFMPALSSTMTEGKIVSWLKNVGDKVKKGEALVVVESDKADMDVESFADGILGAIVVQEGERAVVGAPIAFVAENANEAPAAAPAPAPAPVAAPAPPAPTPVPAAPVGRADGRIVATPYAKQLAKDLKVDLATVAGTGPNGRITAADATTVSELRGTTKPFSTLQAAVARNMNESLKVPEFRVSYAITTDKLDALYQQLKPKGVTMTALLAKACGVALAKHPLLYAACTPDGNGITYSSQINVALAVAMPDGGLITPVLKNADSTDLYQMSRNWADLVKRARSKQLQPDEYNSGNFTISNLGMYGVETFDAILPPGTAAIMAVGGSKPTVVASPDGMIGVKKVMNVNLTADHRIVYGADAAEFLQTLKAVIENPDQLLF
Structure Information
PDB ID
Quaternary structurepart of large multiprotein pyruvate dehydrogenase complex, and also part of a different complex with mRNA, which complex it enters in depends on whether light or acetate is being used as an energy source
Function 1
Function descriptionenzyme, pyruvate dehydrogenase complex subunit in chloroplast, dihydrolipoamide acetyltransferase (DLA2), helps provide acetyl-CoA for fatty acid synthesis
References for functionBohne AV, Schwarz C, Schottkowski M, Lidschreiber M, Piotrowski M, Zerges W, Nickelsen J. Reciprocal regulation of protein synthesis and carbon metabolism for thylakoid membrane biogenesis. PLoS Biol. 2013;11(2):e1001482. doi: 10.1371/journal.pbio.1001482. PMID: 23424285
E.C. number2.3.1.12
Location of functional site(s)
Cellular location of functionchloroplast, complex with RNA in acetate and light-dependent manner
Comments
Function 2
Function descriptionRNA binding
References for functionBohne, Alexandra-Viola, and Jörg Nickelsen. "Metabolic Control of Chloroplast Gene Expression: An Emerging Theme." Molecular plant 10.1 (2017): 1-3.
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Comments