Protein Information

General Information
MoonProt ID33
First appeared in release1.0
Name(s)Enolase 2-phospho-D-glycerate hydro-lyase 2-phosphoglycerate dehydratase
UniProt IDQ7YZX3 (Q7YZX3_ONCVO), Unreviewed
GO termsGO:0006096 glycolysis GO:0000287 magnesium ion binding GO:0004634 phosphopyruvate hydratase activity GO:0000015 phosphopyruvate hydratase complex GO:0005515 protein binding
Organisms for which functions have been demonstratedOnchocerca volvulus
Sequence length435
FASTA sequence>gi|32440997|gb|AAP81756.1| enolase [Onchocerca volvulus] MPITRVHARPIYDSRGNPTVEVDLTTEKGIFRAAVPSGASTGIHEALELRDNDEAVNHGKGVLQAVGNVNEQIGPALVAKNFCPTQQREIDLFMLQLDGTENKAKLGANAILGVSLAVCKAGAVHKGMPLYKYIAELAGTRQIVLPVPAMNVINGGSHAGNKLAMQEFMIMPVGASSFSEAMRMGSEIYHYLKAEIEKRYGLDATAVGDEGGFAPNIQDNKEGLDLLNTAIATAGYTGKVSIAMDCAASEYSKEADKLYDLKFKNPNSGKTQWKTGDQMMNFQSFIKEYPVVSIEDWFHEDDWHNWPKGLAKTNIQIVGDDLTVPNPKRIALAAEKKACNCLLLKVNQIGSVTESIDAANLARKNGWGVMVSHRSGETEDTFIADLVVGLAAGQIKTGAPCRSERLAKYNQILRIEEELGSAAVYAGQKFRNPQA
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionEnolase, enzyme 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate Carbohydrate degradation, glycolysis
References for functionErttmann, Klaus D., et al. "Cloning, characterization and DNA immunization of an Onchocerca volvulus glyceraldehyde-3-phosphate dehydrogenase (Ov-GAPDH)." Biochimica et Biophysica Acta (BBA)-Molecular Basis of Disease 1741.1 (2005): 85-94.
E.C. number4.2.1.11
Location of functional site(s)Active site:345,210 Binding site:158,396,295,167,320
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds plasminogen
References for functionJolodar, A., Fischer, P., Bergmann, S., Buttner, D. W., Hammerschmidt, S. & Brattig, N. W. (2003). Molecular cloning of an a-enolase from the human filarial parasite Onchocerca volvulus that binds human plasminogen.Biochim Biophys Acta. 2003 Jun 19;1627(2-3):111-20.PMID: 12818429
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments