Protein Information

General Information
MoonProt ID334
First appeared in release2.0
Name(s)enolase, Gene: enoI
UniProt IDB8Q027 (B8Q027_9BILA)
GO termsGO:0006096 glycolytic process GO:0000287 magnesium ion binding GO:0004634 phosphopyruvate hydratase activity GO:0016829 lyase activity GO:0000015 phosphopyruvate hydratase complex GO:0044414 suppression of host defenses
Organisms for which functions have been demonstratedSteinernema glaseri (nematode)
Sequence length436 amino acids
FASTA sequence>tr|B8Q027|B8Q027_9BILA Enolase OS=Steinernema glaseri GN=enol PE=2 SV=2 MPITRIHARQIYDSRGNPTVEVDLHTEKGVFRAAVPSGASTGIHEALELRDQDKAVHHGKGVEKAVANVIEKIAPALIAKNFDVTDQVAIDKFMIELDGTENKSSLGANAILGVSLAVAKAGAVHKGVPLYKHLADLAGVSKVVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAKSFKEAMRMGSEIYHHLKAEIKKRYGLDATAVGDEGGFAPNIQDNKEGLDLLNTAIKLAGYTGLVSIGMDVAASEFYKENEKKYDLDFKNPNSDPSKWINGDELAALYQSFIKDYPVVSIEDAFDQDDWANWSKLMGNTSIQLVGDDLTVTNPKRIQMAVDQKACNCLLLKVNQIGSITESIEAAKLSRANGWGVMVSHRSGETEDCFIADLVVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGENFRNPQI
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionenolase
References for functionLiu H, Zeng H, Yao Q, Yuan J, Zhang Y, Qiu D, Yang X, Yang H, Liu Z.. Steinernema glaseri sur-face enolase: molecular cloning, biological characterization, and role in hostimmune suppression. Mol Biochem Parasitol 2012;185:89–98. PMID: 22750626.
E.C. number4.2.1.11
Location of functional site(s)binding site: 158, 167, 296, 321, 397; active site: 210, 346
Cellular location of function
Comments
Function 2
Function descriptionantiphagocytic activity of host (insect), affects host immune system, host immune suppression
References for function
E.C. number
Location of functional site(s)
Cellular location of functionnematode cuticle and surface coat, also secreted into host hemolymph
Comments