Protein Information

General Information
MoonProt ID349
First appeared in release2.0
Name(s)glutathione S-transferase M3, GSTM, glutathione S-transferase Mu 3, GST class-mu 3, GSTM3-3, hGSTM3-3 Gene: GSTM3
UniProt IDP21266 (GSTM3_HUMAN)
GO termsGO:0006749 glutathione metabolic process GO:0008065 establishment of blood-nerve barrier GO:0008152 metabolic process GO:0018916 nitrobenzene metabolic process GO:0042178 xenobiotic catabolic process GO:0043627 response to estrogen GO:0070458 cellular detoxification of nitrogen compound GO:1901687 glutathione derivative biosynthetic process GO:0004364 glutathione transferase activity GO:0016740 transferase activity GO:0019899 enzyme binding GO:0042802 identical protein binding GO:0042803 protein homodimerization activity GO:0043295 glutathione binding GO:0005634 nucleus GO:0005737 cytoplasm GO:0005829 cytosol GO:0035686 sperm fibrous sheath GO:0070062 extracellular exosome GO:0005515 protein binding
Organisms for which functions have been demonstratedHomo sapiens (human)
Sequence length225 amino acids
FASTA sequence>sp|P21266|GSTM3_HUMAN Glutathione S-transferase Mu 3 OS=Homo sapiens GN=GSTM3 PE=1 SV=3 MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Structure Information
PDB ID3GTU
Quaternary structure
Function 1
Function descriptionglutathione S-transferase
References for functionMannervik, Bengt, et al. "Nomenclature for mammalian soluble glutathione transferases." Methods in enzymology 401 (2005): 1-8.
E.C. number2.5.1.18
Location of functional site(s)binding site: 120
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds to rhZP4, in head of sperm, interactions with zona pellucida proteins of egg
References for function9425104
E.C. number
Location of functional site(s)
Cellular location of functionsperm membrane
Comments