Protein Information

General Information
MoonProt ID350
First appeared in release2.0
Name(s)glutathione S-transferase, GST, GST Mu, Glutathione S-transferase Mu, Class mu glutathione S-transferase
UniProt IDQ9MZB4 (Q9MZB4_CAPHI)
GO termsGO:0008152 metabolic process GO:0004364 glutathione transferase activity GO:0016740 transferase activity GO:0005515 protein binding
Organisms for which functions have been demonstratedCapra hircus (goat)
Sequence length188 amino acids
FASTA sequence>tr|Q9MZB4|Q9MZB4_CAPHI Class mu glutathione S-transferase (Fragment) OS=Capra hircus PE=2 SV=1 RLLLEYTDSNYEEKKYTMGDAPDYDRSQWLNEKSKLGLDFPNLPYLIDGTHKLTQSNAILRHIARKYNMCGETEEEKIRVDLLENQVMDVRLHMARICYSPDFEKLKPGYLKEIPGRMKLFSVFLGKRCWFAGNKLTYVDFLAYDILDLQRIFEPRCLDEFRNLKDFLTRFEGLKKISGYMKSSRFLP
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglutathione S-transferase, detoxify electrophilic compounds
References for functionHemachand T, Gopalakrishnan B, Salunke DM, Totey SM, Shaha C. Sperm plasma-membrane-associated glutathione S-transferases as gamete recognition molecules. J Cell Sci 2002;115:2053–2065. PMID: 11973347.
E.C. number2.5.1.18
Location of functional site(s)
Cellular location of functioncatalytically active on sperm plasma membrane
Comments
Function 2
Function descriptionbinds ZP3 protein component of zona pellucida, serves as a gamete recognition molecule, binds specifically to zona pellucida (of egg) during the first phase of sperm–oocyte interactions
References for function11973347
E.C. number
Location of functional site(s)
Cellular location of functionsurface of sperm plasma membrane, attached by non-covalent methods
Commentsanti-GST antibodies prevent fertilization but not GST catalytic activity