Protein Information

General Information
MoonProt ID352
First appeared in release2.0
Name(s)glycerol 3-phosphate dehydrogenase, Gpd2, Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial Gene: GPD2
UniProt IDP41911 (GPD2_YEAST)
GO termsGO:0005975 carbohydrate metabolic process GO:0006071 glycerol metabolic process GO:0006072 glycerol-3-phosphate metabolic process GO:0006116 NADH oxidation GO:0046168 glycerol-3-phosphate catabolic process GO:0055114 oxidation-reduction process GO:0004367 glycerol-3-phosphate dehydrogenase [NAD+] activity GO:0005515 protein binding GO:0016491 oxidoreductase activity GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0042803 protein homodimerization activity GO:0051287 NAD binding GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005829 cytosol GO:0009331 glycerol-3-phosphate dehydrogenase complex
Organisms for which functions have been demonstratedCandida albicans
Sequence length371 amino acids
FASTA sequence>sp|P41911|GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPD2 PE=1 SV=2 MLAVRRLTRYTFLKRTHPVLYTRRAYKILPSRSTFLRRSLLQTQLHSKMTAHTNIKQHKHCHEDHPIRRSDSAVSIVHLKRAPFKVTVIGSGNWGTTIAKVIAENTELHSHIFEPEVRMWVFDEKIGDENLTDIINTRHQNVKYLPNIDLPHNLVADPDLLHSIKGADILVFNIPHQFLPNIVKQLQGHVAPHVRAISCLKGFELGSKGVQLLSSYVTDELGIQCGALSGANLAPEVAKEHWSETTVAYQLPKDYQGDGKDVDHKILKLLFHRPYFHVNVIDDVAGISIAGALKNVVALACGFVEGMGWGNNASAAIQRLGLGEIIKFGRMFFPESKVETYYQESAGVADLITTCSGGRNVKVATYMAKTGKSALEAEKELLNGQSAQGIITCREVHEWLQTCELTQEFPLFEAVYQIVYNNVRMEDLPEMIEELDIDDE
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglycerol 3-phosphate dehydrogenase, functions in glycerol accumulation
References for functionEriksson P., Andre L., Ansell R., Blomberg A., Adler L. Cloning and characterization of GPD2, a second gene encoding sn-glycerol 3-phosphate dehydrogenase (NAD+) in Saccharomyces cerevisiae, and its comparison with GPD1. Mol. Microbiol. 17:95-107(1995). PMID: 7476212
E.C. number1.1.1.8
Location of functional site(s)binding site: 178, 201, 234, 359, 388; active site: 294; nucleotide binding: 90-95
Cellular location of functioncytoplasm
CommentsNAD dependent enzyme
Function 2
Function descriptionplasminogen binding
References for functionLuo S, Hoffmann R, Skerka C, Zipfel PF. 2013. Glycerol-3-phosphate dehydrogenase 2 is a novel factor H-, factor H-like protein 1-, and plasminogenbinding surface protein of Candida albicans. J Infect Dis 207:594-603.
E.C. number
Location of functional site(s)
Cellular location of functioncell surface
Commentslysine analogue aminocaproic acid (?ACA) inhibits Gpd2-plasminogen interaction
Third Function
Function descriptionbinds down-regulators of the complement system FH (factor H) and FHL-1 (factor H-like protein 1), which helps in immune evasion by inactivation of the complement cascade
References for function
E.C. number
Location of functional site(s)
Cellular location of functioncell surface
Comments