Protein Information

General Information
MoonProt ID362
First appeared in release2.0
Name(s)Hsp60, 60 kDa heat shock protein, mitochondrial Gene: Hsp60
UniProt IDP19882
GO termsGO:0006457 protein folding GO:0006458 'de novo' protein folding GO:0006626 protein targeting to mitochondrion GO:0007005 mitochondrion organization GO:0009408 response to heat GO:0034605 cellular response to heat GO:0042026 protein refolding GO:0009408 response to heat GO:0000166 nucleotide binding GO:0005524 ATP binding GO:0051082 unfolded protein binding GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005743 mitochondrial inner membrane GO:0005759 mitochondrial matrix GO:0005811 lipid particle GO:0005875 microtubule associated complex GO:0003677 DNA binding GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length572 amino acids
FASTA sequence>sp|P19882|HSP60_YEAST Heat shock protein 60, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP60 PE=1 SV=1 MLRSSVVRSRATLRPLLRRAYSSHKELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVL IEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAI FTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVG KLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPL LLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAP GFGDNRKNTIGDIAVLTGGTVFTEELDLKPEQCTIENLGSCDSITVTKEDTVILNGSGPK EAIQERIEQIKGSIDITTTNSYEKEKLQERLAKLSGGVAVIRVGGASEVEVGEKKDRYDD ALNATRAAVEEGILPGGGTALVKASRVLDEVVVDNFDQKLGVDIIRKAITRPAKQIIENA GEEGSVIIGKLIDEYGDDFAKGYDASKSEYTDMLATGIIDPFKVVRSGLVDASGVASLLA TTEVAIVDAPEPPAAAGAGGMPGGMPGMPGMM
Structure Information
PDB IDNone, but structures of homologues from other specieis are available
Quaternary structure
Function 1
Function descriptionchaperonin
References for functionJohnson, Rollin B., et al. "Cloning and characterization of the yeast chaperonin HSP60 gene." Gene 84.2 (1989): 295-302.
E.C. number
Location of functional site(s)
Cellular location of functionmitochondria
Comments
Function 2
Function descriptionbinds DNA, bind the template strand of active mtDNA ori sequences in vitro, involved in structure and transmission of mitochondrial DNA nucleoids to daughter cells
References for functionKaufman, B.A., Kolesar, J.E., Perlman, P.S. and Butow, R.A. (2003) A function for the mitochondrial chaperonin Hsp60 in the structure and transmission of mitochondrial DNA nucleoids in Saccharomyces cerevisiae. J. Cell Biol. 163, 457–461. PMID: 14597775
E.C. number
Location of functional site(s)
Cellular location of functionmitochondria
Comments