Protein Information

General Information
MoonProt ID365
First appeared in release2.0
Name(s)lactate dehydrogenase isozyme M, LDH M, L-lactate dehydrogenase A chain, LDH muscle subunit, LDH-M, LDH-A, Gene: Ldha
UniProt IDP06151 (LDHA_MOUSE)
GO termsGO:0005975 carbohydrate metabolic process GO:0019244 lactate biosynthetic process from pyruvate GO:0019661 glucose catabolic process to lactate via pyruvate GO:0019752 carboxylic acid metabolic process GO:0031668 cellular response to extracellular stimulus GO:0055114 oxidation-reduction process GO:0003824 catalytic activity GO:0004457 lactate dehydrogenase activity GO:0004459 L-lactate dehydrogenase activity GO:0005515 protein binding GO:0016491 oxidoreductase activity GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0005634 nucleus GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005829 cytosol GO:0016020 membrane GO:0035686 sperm fibrous sheath GO:0070062 extracellular exosome GO:0003723 RNA binding GO:0003730 mRNA 3-UTR binding
Organisms for which functions have been demonstratedMus musculus (mouse)
Sequence length332 amino acids
FASTA sequence>sp|P06151|LDHA_MOUSE L-lactate dehydrogenase A chain OS=Mus musculus GN=Ldha PE=1 SV=3 MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF
Structure Information
PDB IDNone, but rat, human, rabbit in PDB
Quaternary structuretetramer
Function 1
Function descriptionenzyme, lactate + NAD+ -> pyruvate + NADH
References for functionSakai, Ikuya, Farida S. Sharief, and S. S. L. Li. "Molecular cloning and nucleotide sequence of the cDNA for sperm-specific lactate dehydrogenase-C from mouse." Biochemical Journal 242.2 (1987): 619-622.
E.C. number1.1.1.27
Location of functional site(s)Rossman fold
Cellular location of functioncytoplasm
Commentsupregulation of LDH seen in some cancers, but not clear which function (or both) involved
Function 2
Function descriptionRNA binding protein, post-transcriptional regulation of gene expression, AU-rich element (ARE, binding to these kinds of elements can be involved in affecting RNA stability) binding protein (AUBP), role may also involve binding to AUF1 protein, binds the 3 -UTR of GM-CSF RNA
References for function12107167
E.C. number
Location of functional site(s)Rossman fold also involved in this function, so probably cannot perform both functions simultaneously, binding to RNA competed by NAD+
Cellular location of function
Comments