Protein Information

General Information
MoonProt ID369
First appeared in release2.0
Name(s)PAPS-red A, phosphoadenosine-phosphosulfate reductase, Gene: GSTUM_00002663001
UniProt IDD5G7U8 (D5G7U8_TUBMM)
GO termsGO:0008152 metabolic process GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) GO:0055114 oxidation-reduction process GO:0003824 catalytic activity GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity GO:0006351 transcription, DNA-templated GO:0003677 DNA binding
Organisms for which functions have been demonstratedTuber melanosporum (Perigord black truffle, filamentous mycorrhizal ascomycetous fungus)
Sequence length273 amino acids
FASTA sequence>tr|D5G7U8|D5G7U8_TUBMM Uncharacterized protein OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00002663001 PE=4 SV=1 MPDVYFSSPHLKYLNQQLQTLEPEEILKWCMISLPNLFQTTAFGLTGLVTLDMLSRINAGAPRQIDLIFLDTLYHFDETLELVDRVRERYPNSKLHIYKPSGCANARDFECIHGDNLWDTNDNLYDYLAKVEPAQRAYAELNVKAVLTGRRKSQGGKRGDLDIIGLDDAGLIKVNPLANWTFKQVREYVTKYNVPYNSLLDMGYKSIGDWHSTSPIAEGEDERSGRWKGTNKTECGIHNHRSKYAEYLLQQEQKKNGEALVDALHEVGLQWAI
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionphosphoadenosine-phosphosulfate reductase (thioredoxin), enzyme in sulfur assimilation, conversion of activated sulfate (PAPS) to sulfite, adenosine 3',5'-bisphosphate + sulfite + thioredoxin disulfide <-> 3'-phosphoadenylyl sulfate + thioredoxin
References for functionLevati E, Sartini S, Bolchi A, Ottonello S, Montanini B. Moonlighting transcriptional activation function of a fungal sulfur metabolism enzyme. Sci Rep. 2016 6:25165. doi: 10.1038/srep25165. PMID: 27121330.
E.C. number1.8.4.8
Location of functional site(s)
Cellular location of function
CommentsLevati and coworkers note it "is expressed at high levels in fruiting bodies, where sulfur assimilation is also involvedin the production of secondary sulfur metabolites (S-Volatile Organic Compounds; S-VOCs) as components of the truffle aroma."
Function 2
Function descriptiontranscription factor
References for function27121330
E.C. number
Location of functional site(s)C-terminal polypeptide containing an alternating hydrophilic/hydrophobic amino acid motif involved
Cellular location of functionnucleus
Commentstranscription factor function not found in PAPS-red B variant, which has 99% sequence identity