Protein Information

General Information
MoonProt ID370
First appeared in release2.0
Name(s)2-cys class peroxiredoxin, mitochondrial 2-cysteine peroxiredoxin, mTXNPx, peroxidoxin Gene: mTXNPx
UniProt IDQ95U89 (Q95U89_LEIIN)
GO termsGO:0055114 oxidation-reduction process GO:0098869 cellular oxidant detoxification GO:0004601 peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0051920 peroxiredoxin activity GO:0061077 chaperone-mediated protein folding
Organisms for which functions have been demonstratedLeishmania infantum
Sequence length226 amino acids
FASTA sequence>tr|Q95U89|Q95U89_LEIIN Peroxidoxin OS=Leishmania infantum GN=mTXNPx PE=4 SV=1 MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINMNDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM
Structure Information
PDB IDNone, but close homologue Leishmania braziliensis with 89% amino acid sequence identity
Quaternary structure
Function 1
Function descriptionperoxidase activity, detoxification of reactive oxygen species (ROS), removal of peroxide, use redox active cysteine residue (peroxidatic Cys) to reduce substrates like H2O2
References for functionCastro H., Sousa C., Santos M., Cordeiro-da-Silva A., Flohe L., Tomas A.M. Complementary antioxidant defense by cytoplasmic and mitochondrial peroxiredoxins in Leishmania infantum. Free Radic. Biol. Med. 33:1552-1562(2002). PMID: 12446213
E.C. number1.11.1.-
Location of functional site(s)active site: 81
Cellular location of functionmitochondria
Comments
Function 2
Function descriptionchaperone and activators of signal transduction cascades, prevents thermal aggregation of citrate synthase in vitro, lack of expression makes promastigoes more sensitive to temperature in the mammalian host (37°C)
References for function22046130
E.C. number
Location of functional site(s)
Cellular location of function
Comments