Protein Information

General Information
MoonProt ID372
First appeared in release2.0
Name(s)peroxiredoxin 5, Gene: PRDX5
UniProt IDQ9GLW8 (Q9GLW8_PIG)
GO termsGO:0055114 oxidation-reduction process GO:0016491 oxidoreductase activity GO:0005515 protein binding
Organisms for which functions have been demonstratedSus scrofa (pig)
Sequence length162 amino acids
FASTA sequence>tr|Q9GLW8|Q9GLW8_PIG Peroxiredoxin 5 OS=Sus scrofa GN=PRDX5 PE=2 SV=1 MAPIKVGDAIPSVVVFEGEPEKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGIQVVACLSVNDVFVTEMWGRAHNTEGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSLNVEPDDTGLTCSLAPNIISQL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionperoxiredoxin
References for functionVan der Eecken, Valérie, et al. "Mitochondrial targeting of peroxiredoxin 5 is preserved from annelids to mammals but is absent in pig Sus scrofa domesticus." Mitochondrion 11.6 (2011): 973-981.
E.C. number1.11.1.15
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionsperm plasma membrane protein interacting with zona pellucida proteins
References for function17483085
E.C. number
Location of functional site(s)
Cellular location of functionsperm plasma membrane
Comments