Protein Information

General Information
MoonProt ID373
First appeared in release2.0
Name(s)alkyl hydroperoxide reductase AhpC, peroxiredoxin, 2-Cys Peroxiredoxin Alkyl Hydroperoxide Reductase C, Gene: ahpC
UniProt IDE7S2A7 (E7S2A7_STRA8)
GO termsGO:0006979 response to oxidative stress GO:0055114 oxidation-reduction process GO:0098869 cellular oxidant detoxification GO:0004601 peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0051920 peroxiredoxin activity GO:0020037 heme binding
Organisms for which functions have been demonstratedStreptococcus agalactiae, group B Streptococcus
Sequence length186 amino acids
FASTA sequence>tr|E7S2A7|E7S2A7_STRA8 Peroxiredoxin OS=Streptococcus agalactiae (strain ATCC 13813 / DSM 2134 / JCM 5671 / NCIMB 701348 / NCTC 8181) GN=ahpC PE=4 SV=1 MSLVGKEIIEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQEQYETLKSLDVEVYSVSTDTHFVHKAWHDDSDVVGTITYPMIGDPSHLISQGFDVLGQDGLAQRGTFIIDPDGVIQMMEINADGIGRDASTLIDKVRAAQYIRQHPGEVCPAKWKEGAETLTPSLDLVGKI
Structure Information
PDB IDnone, but structures of some homologues
Quaternary structure
Function 1
Function descriptionperoxiredoxin, hydroxyperoxidase activity
References for functionLechardeur D, Fernandez A., Robert B, Gaudu P, Trieu-Cuot P, Lamberet G, Gruss A. (2011) The 2-Cys peroxiredoxin alkyl hydroperoxide reductase c binds heme and participates in its intracellular availability in Streptococcus agalactiae. J. Biol. Chem. 285, 16032–16041. PMID: 20332091
E.C. number1.11.1.15
Location of functional site(s)active site: 47
Cellular location of function
Commentsdoes not require heme for hydroperoxidase activity
Function 2
Function descriptionheme binding protein
References for function20332091
E.C. number
Location of functional site(s)
Cellular location of function
Comments