Protein Information

General Information
MoonProt ID377
First appeared in release2.0
Name(s)phospholipid hydroperoxide glutathione peroxidase (mitochondrial), glutathione peroxidase 4, GPx-4, GSHPx-4, PHGPx, Gene: GPX4
UniProt IDP36969 (GPX4_HUMAN)
GO termsGO:0006644 phospholipid metabolic process GO:0006979 response to oxidative stress GO:0007275 multicellular organism development GO:0019372 lipoxygenase pathway GO:0055114 oxidation-reduction process GO:0098869 cellular oxidant detoxification GO:0004601 peroxidase activity GO:0004602 glutathione peroxidase activity GO:0016491 oxidoreductase activity GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity GO:0005634 nucleus GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005829 cytosol GO:0070062 extracellular exosome GO:0005515 protein binding
Organisms for which functions have been demonstratedHomo sapiens (human)
Sequence length197 amino acids
FASTA sequence>sp|P36969|GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Homo sapiens GN=GPX4 PE=1 SV=3 MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Structure Information
PDB ID2OBI, 2GS3
Quaternary structure
Function 1
Function descriptionphospholipid hydroperoxide glutathione peroxidase, 2 glutathione + a hydroperoxy-fatty-acyl-[lipid] -> glutathione disulfide + a hydroxy-fatty-acyl-[lipid]
References for functionMarotta, Charles A., et al. "Nucleotide Sequence Analysis of Coding and Noncoding Regions of Human beta-Globin mRNA." Progress in nucleic acid research and molecular biology 19 (1977): 165-175.
E.C. number1.11.1.12
Location of functional site(s)active site: 73
Cellular location of functionmitochondria
Comments
Function 2
Function descriptioninteractions with zona pellucida proteins of egg
References for function23355646
E.C. number
Location of functional site(s)
Cellular location of functionhead of sperm, sperm membrane
Comments