Protein Information

General Information
MoonProt ID381
First appeared in release2.0
Name(s)pyruvate dehydrogenase E2 subunit, pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase, Gene: pdhC
UniProt IDQ6HEJ4 (Q6HEJ4_BACHK)
GO termsGO:0008152 metabolic process GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups GO:0006351 transcription, DNA-templated GO:0003677 DNA binding
Organisms for which functions have been demonstratedBacillus thuringiensis
Sequence length429 amino acids
FASTA sequence>tr|Q6HEJ4|Q6HEJ4_BACHK Pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdhC PE=3 SV=1 MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVLVEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNERVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA
Structure Information
PDB ID3DUF
Quaternary structure
Function 1
Function descriptionpyruvate dehydrogenase E2 subunit, dihydrolipoamide acetyltransferase
References for functionWalter, Thomas, and Arthur Aronson. "Specific binding of the E2 subunit of pyruvate dehydrogenase to the upstream region of Bacillus thuringiensis protoxin genes." Journal of Biological Chemistry 274.12 (1999): 7901-7906.
E.C. number2.3.1.12
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionDNA binding, transcription regulation
References for function10075684
E.C. number
Location of functional site(s)
Cellular location of functionbinding to DNA
Comments