Protein Information

General Information
MoonProt ID387
First appeared in release2.0
Name(s)DNA-directed RNA polymerase beta subunit, Gene: rpoB
UniProt IDABAZI3
GO termsGO:0006351 transcription, DNA-templated GO:0003677 DNA binding GO:0003899 DNA-directed RNA polymerase activity GO:0032549 ribonucleoside binding GO:0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus gordonii
Sequence length226 amino acids
FASTA sequence>sp|A8AZI3|RPOB_STRGC DNA-directed RNA polymerase subunit beta OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) GN=rpoB PE=3 SV=1 MAGHDVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKDFLDHGLKEVFEDVLPISNFTD TMELEFVGYEIREPKYTLEEARIHDASYSAPIFVTFRLINKETGEIKTQEVFFGDFPIMT EMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKIGYGSTVIPNRGAWLELETDSKDIA YTRIDRTRKIPFTTLVRALGFSGDDEIFDIFGDSDLVRNTIEKDIHKNPMDSRTDEALKE IYERLRPGEPKTAESSRSLLVARFFDPHRYDLAAVGRYKINKKLNIKTRLLNQTIAEPLV DAETGEILVEAGTLMTRSVIDSIAEQLDNGLNKITYIPNDSAVLTEPVELQKFKVVAPTD PDRVVTIIGNANPSDKVRTVTPADILAEMSYFLNLAEGIGRVDDIDHLGNRRIRAVGELL ANQVRLGLSRMERNVRERMSVQDNEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNP LSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGH LNKYGFIQTPYRKVDREAGVVTNEIVWLTADEEDEFIVAQANSKLNEEGGFAEPIVMGRH QGNNQEFPSDQVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAP YVGTGMEYQAAHDSGAAVIAQHDGKVTYADADKVEVRREDGSLDVYHIQKFRRSNSGTAY NQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKD DVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVG KVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSG VNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPS RMNIGQVMELHLGMAARNLGIHIATPVFDGASSDDLWDTVREAGMDSDAKTVLYDGRTGE PFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSMVTQQPLGGKAQFGGQRFGEMEVWALE AYGASNVLQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRV LDEDDNEVELRDLDEGEDDDVIHVDDLEKAREKAAQEAKAAFEAEGKE
Structure Information
PDB IDnone, structures of some homologues are available
Quaternary structureforms RNAP catalytic core with 2 alpha, 1 beta, 1 beta' and 1 omega subunits
Function 1
Function descriptionbeta subunit of DNA-directed RNA polymerase
References for functionVickerman, M. M., et al. "Genome-wide transcriptional changes in Streptococcus gordonii in response to competence signaling peptide." Journal of bacteriology 189.21 (2007): 7799-7807.
E.C. number2.7.7.6
Location of functional site(s)
Cellular location of functionassociated with DNA in cell
Comments
Function 2
Function descriptionMuc7 binding protein
References for function19671172
E.C. number
Location of functional site(s)
Cellular location of functioncell surface
Comments