Protein Information

General Information
MoonProt ID390
First appeared in release2.0
Name(s)succinate dehydrogenase subunit 3, sdh3, Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial, CYB3 Gene: SDH3
UniProt IDP33421 (SDH3_YEAST)
GO termsGO:0006099 tricarboxylic acid cycle GO:0006121 mitochondrial electron transport, succinate to ubiquinone GO:0045039 protein import into mitochondrial inner membrane GO:0045333 cellular respiration GO:0055114 oxidation-reduction process GO:0000104 succinate dehydrogenase activity GO:0009055 electron carrier activity GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors GO:0046872 metal ion binding GO:0048038 quinone binding GO:0008177 succinate dehydrogenase (ubiquinone) activity GO:0005739 mitochondrion GO:0005743 mitochondrial inner membrane GO:0005749 mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) GO:0016020 membrane GO:0016021 integral component of membrane GO:0042721 mitochondrial inner membrane protein insertion complex GO:0005515 protein binding GO:0042721 mitochondrial inner membrane protein insertion complex GO:0005743 mitochondrial inner membrane
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length198 amino acids
FASTA sequence>sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 MSAMMVKLGLNKSALLLKPSAFSRAAALSSSRRLLFNTARTNFLSTSPLKNVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLFTILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAKELTLKGVYRTGYALIGFTAVLGTYLLTL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionsubunit of succinate dehydrogenase in the respiratory chain, electron transport in respiratory complex II
References for functionSun, F., Huo, X., Zhai, Y., Wang, A., Xu, J., Su, D., Bartlam, M., and Rao, Z.(2005). Crystal structure of mitochondrial respiratory membrane protein complex II. Cell 121, 1043–1057. PMID: 15989954. Lemire, B.D., and Oyedotun, K.S. (2002). The Saccharomyces cerevisiae mitochondrial succinate:ubiquinone oxidoreductase. Biochim. Biophys. Acta 1553, 102–116. PMID: 11803020. Yankovskaya, V., Horsefield, R., To¨ rnroth, S., Luna-Chavez, C., Miyoshi, H., Leger, C., Byrne, B., Cecchini, G., and Iwata, S. (2003). Architecture of succinate dehydrogenase and reactive oxygen species generation. Science 299, 700–704. PMID: 12560550.
E.C. number1.3.5.1
Location of functional site(s)binding site: 93, 97; metal binding: 156
Cellular location of functiontransmembrane protein in mitochondrial inner membrane
Comments
Function 2
Function descriptionpart of TIM22 complex (carrier translocase, mitochondrial inner membrane translocase) in mitochondria, helps in biogenesis and assembly of membrane-integral subunits of TIM22 complex
References for function22152483
E.C. number
Location of functional site(s)
Cellular location of functiontransmembrane protein in mitochondrial inner membrane
Comments