Protein Information

General Information
MoonProt ID391
First appeared in release2.0
Name(s)superoxide dismutase, sod1, Superoxide dismutase [Cu-Zn] Gene: SOD1
UniProt IDP00445 (SODC_YEAST)
GO termsGO:0001320 age-dependent response to reactive oxygen species involved in chronological cell aging GO:0006801 superoxide metabolic process GO:0006878 cellular copper ion homeostasis GO:0006882 cellular zinc ion homeostasis GO:0019430 removal of superoxide radicals GO:0031505 fungal-type cell wall organization GO:0036091 positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress GO:0050821 protein stabilization GO:0051091 positive regulation of sequence-specific DNA binding transcription factor activity GO:0055114 oxidation-reduction process GO:0098869 cellular oxidant detoxification GO:1901856 negative regulation of cellular respiration GO:0004784 superoxide dismutase activity GO:0005507 copper ion binding GO:0005515 protein binding GO:0008270 zinc ion binding GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0046872 metal ion binding GO:0005634 nucleus GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005758 mitochondrial intermembrane space GO:0005829 cytosol GO:0006351 transcription, DNA-templated GO:0003677 DNA binding
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length154 amino acids
FASTA sequence>sp|P00445|SODC_YEAST Superoxide dismutase [Cu-Zn] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOD1 PE=1 SV=2 MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Structure Information
PDB ID1F1G, 1F1A, 1F18, 1SDY, 1F1D, 1JK9, 1B4T
Quaternary structure
Function 1
Function descriptionsuperoxide dismutase, catalysis of superoxide (O2-) to hydrogen peroxide (H2O2), remove reactive oxygen species, 2 superoxide -> oxygen and H2O2
References for functionBermingham-Mcdonogh O., Gralla E., Valentine J. The copper, zinc-superoxide dismutase gene of Saccharomyces cerevisiae: cloning, sequencing, and biological activity. Proc. Natl. Acad. Sci. U.S.A. 85:4789-4793(1988). PMID: 3290902
E.C. number1.15.1.1
Location of functional site(s)metal binding: 43, 47, 49, 64, 72, 81, 84, 121; binding site: 144
Cellular location of function
Comments
Function 2
Function descriptionbinds DNA, transcription factor in response to H2O2, a reactive oxygen species (ROS), regulates expression of genes involved in oxidative resistance and DNA damage repair, ROS treatment increases Sod1 binding to the promoters of RNR3 and GRE2
References for function24647101
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Commentsregulation of sod1 by phosphorylation at serine 60 and 99