Protein Information

General Information
MoonProt ID395
First appeared in release
Name(s)voltage-dependent anion channel 2, VDAC2, voltage-dependent anion-selective channel protein 2, outer mitochondrial membrane protein porin 2, VDAC-2, hVDAC2, Gene: VDAC2
UniProt IDP45880 (VDAC2_HUMAN)
GO termsGO:0006810 transport GO:0006811 ion transport GO:0006820 anion transport GO:0032272 negative regulation of protein polymerization GO:0044070 regulation of anion transport GO:0055085 transmembrane transport GO:1903959 regulation of anion transmembrane transport GO:2001243 negative regulation of intrinsic apoptotic signaling pathway GO:0000166 nucleotide binding GO:0005515 protein binding GO:0008308 voltage-gated anion channel activity GO:0015288 porin activity GO:0005634 nucleus GO:0005739 mitochondrion GO:0005741 mitochondrial outer membrane GO:0005743 mitochondrial inner membrane GO:0008021 synaptic vesicle GO:0016020 membrane GO:0016021 integral component of membrane GO:0042645 mitochondrial nucleoid GO:0043209 myelin sheath GO:0045121 membrane raft GO:0046930 pore complex GO:0070062 extracellular exosome
Organisms for which functions have been demonstratedHomo sapiens, human
Sequence length294 amino acids
FASTA sequence>sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionvoltage-dependent anion channel 2 (VDAC2), transports adenine nucleotides, Ca2+ and other metabolites, voltage-dependent
References for functionBlachly-Dyson E., Zambronicz E.B., Yu W.H., Adams V., McCabe E.R., Adelman J.P., Colombini M., Forte M.A. Cloning and functional expression in yeast of two human isoforms of the outer mitochondrial membrane channel, the voltage-dependent anion channel. J. Biol. Chem. 268:1835-1841(1993). PMID: 8420959.
E.C. number
Location of functional site(s)site: 84; nucleotide binding: 253-255, 271-275
Cellular location of functionmitochondrial outer membrane, transmembrane protein
Comments
Function 2
Function descriptionbinds to rhZP2 or rhZP3, zona pellucida proteins of egg
References for function23355646
E.C. number
Location of functional site(s)
Cellular location of functionsperm membrane
Comments