Protein Information

General Information
MoonProt ID397
First appeared in release2.0
Name(s)VPS22, Larsen, GH19864p, Gene: lsn
UniProt IDQ9VD72 (Q9VD72_DROME)
GO termsGO:0007567 parturition GO:0008105 asymmetric protein localization GO:0008283 cell proliferation GO:0008593 regulation of Notch signaling pathway GO:0019233 sensory perception of pain GO:0032509 endosome transport via multivesicular body sorting pathway GO:0036258 multivesicular body assembly GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway GO:0042981 regulation of apoptotic process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway GO:0043328 protein targeting to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway GO:0045450 bicoid mRNA localization GO:0003674 molecular_function GO:0000814 ESCRT II complex GO:0003729 mRNA binding
Organisms for which functions have been demonstratedDrosophila melanogaster
Sequence length254 amino acids
FASTA sequence>tr|Q9VD72|Q9VD72_DROME GH19864p OS=Drosophila melanogaster GN=lsn PE=1 SV=1 MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKNSQFRKQFQEMCAAIGVDPLATGKGFWSVLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFPSLFPGRNAQTTAAT
Structure Information
PDB IDnone, but structures available of homologues
Quaternary structure
Function 1
Function descriptioncomponent of ESCRT-II (endosomal sorting complex required for transport), functions in exosomal sorting pathway that sorts ubiquitinated endosomal proteins into internal vesicles
References for functionKaminker, Joshua S., et al. "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective." Genome biology 3.12 (2002): research0084-1.
E.C. number
Location of functional site(s)
Cellular location of function
Comments
Function 2
Function descriptionbind bicoid mRNA to cause localization to anterior of egg
References for functionIrion U, St Johnston D. (2007) bicoid RNA localization requires specific binding of an endosomal sorting complex. Nature 445, 554–558. PMID: 17268469.
E.C. number
Location of functional site(s)
Cellular location of functionegg
Comments