Protein Information

General Information
MoonProt ID398
First appeared in release2.0
Name(s)VPS25, Vacuolar protein-sorting-associated protein 25, ESCRT-II complex subunit VPS25, Vacuolar protein sorting 25 Gene: Vps25
UniProt IDQ7JXV9 (VPS25_DROME)
GO termsGO:0006810 transport GO:0007293 germarium-derived egg chamber formation GO:0008105 asymmetric protein localization GO:0008283 cell proliferation GO:0008593 regulation of Notch signaling pathway GO:0010669 epithelial structure maintenance GO:0010669 epithelial structure maintenance GO:0015031 protein transport GO:0016197 endosomal transport GO:0019233 sensory perception of pain GO:0030154 cell differentiation GO:0030713 ovarian follicle cell stalk formation GO:0032509 endosome transport via multivesicular body sorting pathway GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway GO:0042981 regulation of apoptotic process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway GO:0043328 protein targeting to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway GO:0045199 maintenance of epithelial cell apical/basal polarity GO:0045450 bicoid mRNA localization GO:0048803 imaginal disc-derived male genitalia morphogenesis GO:0050680 negative regulation of epithelial cell proliferation GO:0060429 epithelium development GO:0070086 ubiquitin-dependent endocytosis GO:0097352 autophagosome maturation GO:0005198 structural molecule activity GO:0042803 protein homodimerization activity GO:0000814 ESCRT II complex GO:0005737 cytoplasm GO:0005768 endosome GO:0010008 endosome membrane GO:0016020 membrane GO:0003729 mRNA binding
Organisms for which functions have been demonstratedDrosophila melanogaster
Sequence length174 amino acids
FASTA sequence>sp|Q7JXV9|VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster GN=Vps25 PE=1 SV=1 MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF
Structure Information
PDB IDnone, but structures of homologues are available
Quaternary structure
Function 1
Function descriptioncomponent of ESCRT-II (endosomal sorting complex required for transport), functions in exosomal sorting pathway that sorts ubiquitinated endosomal proteins into internal vesicles
References for functionThompson, Barry J., et al. "Tumor suppressor properties of the ESCRT-II complex component Vps25 in Drosophila." Developmental cell 9.5 (2005): 711-720.
E.C. number
Location of functional site(s)
Cellular location of function
Comments
Function 2
Function descriptionbind bicoid mRNA to cause localization to anterior of egg
References for functionIrion U, St Johnston D. (2007) bicoid RNA localization requires specific binding of an endosomal sorting complex. Nature 445, 554–558. PMID: 17268469.
E.C. number
Location of functional site(s)
Cellular location of functionegg
Comments