Protein Information

General Information
MoonProt ID46
First appeared in release1.0
Name(s)Fructose-bisphosphate aldolase FBP aldolase FBPA 37 kDa major allergen Fructose-1,6-bisphosphate aldolase IgE-binding allergen Gene Name: FBA1
UniProt IDQ9URB4 (ALF_CANAL), Reviewed
GO termsGO:0005975 carbohydrate metabolic process GO:0006096 glycolysis GO:0044416 induction by symbiont of host defense response GO:0051701 interaction with host GO:0003824 catalytic activity GO:0004332 fructose-bisphosphate aldolase activity GO:0005515 protein binding GO:0008270 zinc ion binding GO:0016829 lyase activity GO:0016832 aldehyde-lyase activity GO:0046872 metal ion binding GO:0005737 cytoplasm GO:0005886 plasma membrane GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0030446 hyphal cell wall GO:0005515 protein binding
Organisms for which functions have been demonstratedCandida albicans
Sequence length359
FASTA sequence>sp|Q9URB4|ALF_CANAL Fructose-bisphosphate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FBA1 PE=1 SV=2 MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionFructose bisphosphate aldolase, enzyme D-fructose 1,6-bisphosphate <=> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis Carbohydrate degradation, glycolysis, gluconeogenesis
References for functionPitarch, Aida, et al. "Analysis of the serologic response to systemic Candida albicans infection in a murine model." Proteomics 1.4 (2001): 550-559.
E.C. number4.1.2.13
Location of functional site(s)Active site:109 Binding site:62,227 Metal binding site:110,226,174,265,144
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID:12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments