Protein Information

General Information
MoonProt ID50
First appeared in release1.0
Name(s)GAPDH Glyceraldehyde-3-phosphate dehydrogenase Gene Name: gap
UniProt IDP52987 (G3P_LACLA), Reviewed
GO termsGO:0006006 glucose metabolic process GO:0006096 glycolysis GO:0055114 oxidation-reduction process GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0051287 NAD binding GO:0005737 cytoplasm GO:0005515 protein binding
Organisms for which functions have been demonstratedLactococcus lactis IL1403
Sequence length337
FASTA sequence>sp|P52987|G3P_LACLA Glyceraldehyde-3-phosphate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gap PE=3 SV=2 MVVKVGINGFGRIGRLALRRIQEVEGVEVAHINDLTDPAMLAHLLKYDTTQGRFKGTVEVKEDGFDVNGKFVKVTAERNPEDIQWADSGVEIVLEATGFFATKEKAEKHLHPGGAKKVLITAPGGNDVKTVVFNTNHTILDGTETVISAGSCTTNSLAPMADALNKNFGVKGGTMTTVHSYTGDQMTLDGPHRGGDFRRARAAAENIVPASSGAAKAIGLVLPELSGLMKGHAQRVSTPTGSITELVTVLEKHVTVDEINEAMKAAADESFGYNVDEIVSSDIIGMAYGSLFDATLTEVTDLKDGGQLVKTAAWYDNEMSFTAQLIRTLEYFAKIAK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglyceraldehyde 3-phosphate dehydrogenase, GAPDH, enzyme D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 1,3-bisphospho-D-glycerate + NADH. Carbohydrate degradation, glycolysis
References for functionCocaign-Bousquet, Muriel, et al. "Physiology of pyruvate metabolism in Lactococcus lactis." Antonie van Leeuwenhoek70.2 (1996): 253-267.
E.C. number1.2.1.12
Location of functional site(s)Active site:152 Binding site:182,199,235,78,34,317,121 Nucleotide binding site:12-13 Other functional site:179
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinding to invertase, a hyperglycosylated mannoprotein from Saccharomyces cerevisiae
References for functionKatakura Y, Sano R, Hashimoto T, Ninomiya K, Shioya S. 2010. Lactic acid bacteria display on the cell surface cytosolic proteins that recognize yeast mannan. Appl Microbiol Biotechnol. 2010 Mar;86(1):319-26. doi: 10.1007/s00253-009-2295-y. Epub 2009 Nov 7. PMID: 19898842
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments