Protein Information

General Information
MoonProt ID51
First appeared in release1.0
Name(s)GAPDH Glyceraldehyde-3-phosphate dehydrogenase Gene Name: GPD
UniProt IDQ8X1X3 (G3P_PARBA), Reviewed
GO termsGO:0006006 glucose metabolic process GO:0006096 glycolysis GO:0055114 oxidation-reduction process GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0051287 NAD binding GO:0005737 cytoplasm GO:0098631 cell adhesion mediator GO:0005515 protein binding
Organisms for which functions have been demonstratedParacoccidioides brasiliensis
Sequence length338
FASTA sequence>gi|30995493|gb|AAP42760.1| glyceraldehyde-3-phosphate dehydrogenase [Paracoccidioides brasiliensis] MVVKVGINGFGRIGRIVFRNAVEHDDVEIVAVNDPFIETKYAAYMLKYDSTHGQFKGDIQHSSSNNLTVNNKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEKAKAHLSGGAKKVIISAPSADAPMFVMGVNEKSYRPDISVLSNASCTTNCLAPLAKVIHDNFGIAEGLMTTIHSYTATQKTVDGPSHKDWRGGRTAAQNIIPSSTGAAKAVGKVIPALNGKLTGMAMRVPTANVSVVDLTCRTEKPVTYDQIKAAVKAASEGELKGILGYSEDALVSTDLNGDPRSSIFDASAGIALNDRFVKLISWYDNEWGYSRRVLDLIAYIAKVDAGK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglyceraldehyde 3-phosphate dehydrogenase, enzyme D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 1,3-bisphosphoglycerate + NADH. Carbohydrate degradation, glycolysis
References for functionNogueira, Sarah Veloso, et al. "Paracoccidioides brasiliensis enolase is a surface protein that binds plasminogen and mediates interaction of yeast forms with host cells." Infection and immunity78.9 (2010): 4040-4050.
E.C. number1.2.1.12
Location of functional site(s)Active site:152 Binding site:182,316,234,34,80 Nucleotide binding site:12-13 Other functional site:179
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbind to fibronectin, laminin, and type I collagen
References for functionSj?str?m I, Grndahl H, Falk G, Kronvall G, Ullberg M. Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Biochim Biophys Acta. 1997 Mar 13;1324(2):182-90. PMID: 9092705
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments