Protein Information

General Information
MoonProt ID53
First appeared in release1.0
Name(s)GAPDH Glyceraldehyde-3-phosphate dehydrogenase Plasmin receptor Plasminogen-binding protein gapA, plr Gene Name: gap
UniProt IDP68777 (G3P_STRP8), Reviewed
GO termsGO:0006006 glucose metabolic process GO:0006096 glycolysis GO:0055114 oxidation-reduction process GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0098631 cell adhesion mediator GO:0005515 protein binding GO:0051287 NAD binding GO:0005737 cytoplasm
Organisms for which functions have been demonstratedStreptococcus pyogenes
Sequence length336
FASTA sequence>sp|P68777|G3P_STRP8 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gap PE=3 SV=2 MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglyceraldehyde 3-phosphate dehydrogenase, enzyme D-glyceraldehyde 3-phosphate + phosphate + NAD+ => 1,3-bisphosphoglycerate + NADH. Carbohydrate degradation, glycolysis
References for functiondemonstrated enzyme activity: Pancholi V, Fischetti VA: A major surface protein on group A streptococci is a glyceraldehyde-3-phosphate-dehydrogenase with multiple binding activity. J Exp Med. 1992 Aug 1;176(2):415-26.
E.C. number1.2.1.12
Location of functional site(s)Active site:152 Binding site:182,316,199,235,78,34,121 Nucleotide binding site:12-13 Other functional site:179
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds uPAR/CD87 receptor on human cells
References for functionJin H, Song YP, Boel G, Kochar J, Pancholi V. Group A streptococcal surface GAPDH, SDH, recognizes uPAR/CD87 as its receptor on the human pharyngeal cell and mediates bacterial adherence to host cells. J Mol Biol. 2005 Jul 1;350(1):27-41. PMID: 15922359
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments
Third Function
Function descriptionfibronectin and plasminogen binding
References for functionLottenberg R, Broder CC, Boyle MD, Kain SJ, Schroeder BL, Curtiss R. Cloning, sequence analysis, and expression in Escherichia coli of a streptococcal plasmin receptor. J Bacteriol. 1992 Aug;174(16):5204-10. PMID: 1322883
E.C. number
Location of functional site(s)
Cellular location of function
Comments