Protein Information

General Information
MoonProt ID54
First appeared in release1.0
Name(s)GAPDH Glyceraldehyde-3-phosphate dehydrogenase
UniProt IDQ3Y454 (Q3Y454_STRSU), Unreviewed
GO termsGO:0006006 glucose metabolic process GO:0055114 oxidation-reduction process GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0051287 NAD binding GO:0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus suis (serotype 2)
Sequence length336
FASTA sequence>gi|73612170|gb|AAZ78247.1| glyceraldehyde-3-phosphate dehydrogenase [Streptococcus suis] MVVKVGITGFERIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAERKPGNIDWATDGVDIVLEATGFFASKEKAEQHIHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTEDQLVSSDIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionGAPDH, glyceraldehyde 3-phosphate dehydrogenase, enzyme
References for functionBrassard, Julie, Marcelo Gottschalk, and Sylvain Quessy. "Cloning and purification of the Streptococcus suis serotype 2 glyceraldehyde-3-phosphate dehydrogenase and its involvement as an adhesin." Veterinary microbiology 102.1 (2004): 87-94.
E.C. number1.2.1.12
Location of functional site(s)Active site:152 Binding site:182,235 Other functional site:179
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionJobin MC, Brassard J, Quessy S, Gottschalk M, Grenier D. Acquisition of host plasmin activity by the Swine pathogen Streptococcus suis serotype 2. Infect Immun. 2004 Jan;72(1):606-10. PMID: 14688145
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments