Protein Information

General Information
MoonProt ID57
First appeared in release1.0
Name(s)GAPDH glyceraldehyde 3-phosphate dehydrogenase Gene Name: gap
UniProt IDA0A0H2US80
GO termsGO:0006006 glucose metabolic process GO:0055114 oxidation-reduction process GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0051287 NAD binding GO:0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus pneumoniae
Sequence length335 aa
FASTA sequence>tr|A0A0H2US80|A0A0H2US80_STRPN Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gap PE=1 SV=1 MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGKFIKVSAERDPEQIDWATDGVEIVLEATGFFAKKEAAEKHLKGGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVEGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKAASNESYGYTEDPIVSSDIVGMSYGSLFDATQTKVLDVDGKQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglyceraldehyde 3-phosphate dehydrogenase, enzyme
References for functionCash, Phillip, et al. "A proteomic analysis of erythromycin resistance in Streptococcus pneumoniae." Electrophoresis 20.11 (1999): 2259-2268.
E.C. number1.2.1.12
Location of functional site(s)Active site:151 Binding site:181,234 Other functional site:178
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionBergmann, S., M. Rohde, and S. Hammerschmidt. (2004) Glyceraldehyde-3-phosphate dehydrogenase of Streptococcus pneumoniae is a surface-displayed plasminogen-binding protein. Infect Immun. 2004 Apr;72(4):2416-9. PMID: 15039372. Pancholi, V., and Fischetti, V.A. (1992) A major surface protein on group A streptococci is a glyceraldehyde-3-phosphate dehydrogenase with multiple binding activity. J Exp Med. 1992 Aug 1;176(2):415-26. PMID: 1500854
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments