Protein Information

General Information
MoonProt ID62
First appeared in release1.0
Name(s)GAPDH glyceraldehyde 3-phosphate dehydrogenase Gene Name: plr
UniProt IDQ1J8I3 (Q1J8I3_STRPF)
GO termsGO:0006006 glucose metabolic process GO:0055114 oxidation-reduction process GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity GO:0016491 oxidoreductase activity GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0050661 NADP binding GO:0051287 NAD binding GO:0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus - group A streptococci, group A streptococcal strain 64/14
Sequence length336
FASTA sequence>gi|76363879|sp|P0C0G6.2|G3P_STRPY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH; AltName: Full=Plasmin receptor; AltName: Full=Plasminogen-binding protein MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINSAMKAASNDSFGYTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglyceraldehyde 3-phosphate dehydrogenase, enzyme
References for functionWinram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943
E.C. number1.2.1.12
Location of functional site(s)Active site:161 Binding site:244,191 Other functional site:188
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionPlasminogen binding
References for functionWinram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments