Protein Information

General Information
MoonProt ID63
First appeared in release1.0
Name(s)Glutamine synthetase Gene Name: glnA
UniProt IDC2GUH0 (C2GUH0_BIFLN)
GO termsGO:0006542 glutamine biosynthetic process GO:0006807 nitrogen compound metabolic process GO:0009399 nitrogen fixation GO:0000166 nucleotide binding GO:0003824 catalytic activity GO:0004356 glutamate-ammonia ligase activity GO:0005524 ATP binding GO:0016874 ligase activity GO:0005737 cytoplasm
Organisms for which functions have been demonstratedBifidobacterium (Bifidobacterium lactis, B. bifidum, and B. longum)
Sequence length478
FASTA sequence>gi|494112847|ref|WP_007053626.1| glutamine synthetase [Bifidobacterium longum] MTELKSKEDAEALINKEGIEYVSVRFTDLIGVQQHFTVPASEFLKDAFTDGMPFDGSSVQGFQAINESDMKLVPDVETSFVDPFRKHKTLDVAFSIVDPLTDEPYSRDPRQVAGKAEAYLKSTGIADTASFAPEAEFFIFDKVRFENSMQRSFYEVDSIEAPWNSGVDVEEDGTPNIGFKNRVKKGYFPVPPIDHTQDLRDDMVANLQKVGLILERSHHEVAGAGQQEINYRFNTLQHAGDDLMKYKYVVHETAALAGKAATFMPKPIADDNGTGMHCHQSLWKDGKPLFYDEKGYAGLSDLARWYIGGLIKHSSSVLAFTNPSLNSYHRLVPGFEAPVNLVYSARNRSAAIRIPLAGTSPAAKRIEFRAPDPSCNPFLAFSAQLMAGLDGILNHIEPPEPVDKDLYELPPEEHAGIKQVPSSLAEAMDALEEDHDFLTAGDVFTDDLIETWIGLKRDEIDQARLSPTPLEYELYFHI
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionGlutamine synthetase, enzyme ATP + L-glutamate + NH3 => ADP + phosphate + L-glutamine
References for functionHatanaka, Masayuki, et al. "Distribution and some properties of glutamine synthetase and glutamate dehydrogenase in bifidobacteria." Agricultural and biological chemistry 51.1 (1987): 251-252.
E.C. number6.3.1.2
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCandela M, et al. 2007. Binding of human plasminogen to Bifidobacterium. J Bacteriol. 2007 Aug;189(16):5929-36. Epub 2007 Jun 8. PMID: 17557824
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments