Protein Information

General Information
MoonProt ID64
First appeared in release1.0
Name(s)Glucose-6-phosphate isomerase GPI Phosphoglucose isomerase Phosphohexose isomerase Gene Name: pgi
UniProt IDK1MKZ7
GO termsGO:0006094 gluconeogenesis GO:0006096 glycolysis GO:0004347 glucose-6-phosphate isomerase activity GO:0016853 isomerase activity GO:0005737 cytoplasm GO:0005515 protein binding GO:0098631 cell adhesion mediator activity
Organisms for which functions have been demonstratedLactobacillus crispatus
Sequence length445 aa
FASTA sequence>tr|K1MKZ7|K1MKZ7_9LACO Glucose-6-phosphate isomerase OS=Lactobacillus crispatus FB077-07 GN=pgi PE=3 SV=1 MSLIKFDSSKLTQFVHENELSEMQAMVNAANTELRDGTGAGNDFRGWLNLPVDYDKDEFARIKKAAKKIQSDSEVLICIGIGGSYLGAQAAIEFLNSNFYGKEKNGMPTVVFCGNSLSGSYLYDLIEWLGDKDFSVNVISKSGTTTEPSVAFRIFKDKLIKKYGKEEAAKRIYATTDRQKGALKTEADAEGYEEFVVPDDVGGRYSVLSAVGLLPIAASGADIDELMKGAADARADYTDTDLSKATPYQYAALRNILYRKGYTTEIVENYEPSLRMFGEWCKQLMGESEGKDQKGIYPSSANFTTDLHSLGQYIQEGLRNLFETVIRVENPRHDVKIPGDEKNLDQLNFLEGKSLNYVNDRAYEGVVLAHTDGGVPVMTVNIPDQSAHTLGYMIYFFELAIAISGYLNGINPFNQPGVEAYKRNMFGLLNKPGYENLHDDLAKRL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglucose 6-phosphate isomerase, enzyme D-glucose 6-phosphate <=> D-fructose 6-phosphate Carbohydrate biosynthesis; gluconeogenesis Carbohydrate degradation; glycolysis
References for functionGomes, Ana MP, and F. Xavier Malcata. "Bifidobacterium spp. and Lactobacillus acidophilus: biological, biochemical, technological and therapeutical properties relevant for use as probiotics." Trends in Food Science & Technology 10.4 (1999): 139-157.
E.C. number5.3.1.9
Location of functional site(s)Active site:422
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionlaminin, collagen I binding (not fibronectin)
References for functionKainulainen V, Loimaranta V, Pekkala A, Edelman S, Antikainen J, Kylvj R, Laaksonen M, Laakkonen L, Finne J, Korhonen TK. (2012) Glutamine synthetase and glucose-6-phosphate isomerase are adhesive moonlighting proteins of Lactobacillus crispatus released by epithelial cathelicidin LL-37. J Bacteriol. 2012 May;194(10):2509-19. doi: 10.1128/JB.06704-11. Epub 2012 Mar 2. PMID: 22389474
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments