Protein Information

General Information
MoonProt ID66
First appeared in release1.0
Name(s)Glutamine synthetase A1 GlnA1 Glutamine synthetase Gene Name: glnA1
UniProt IDA0A0H3LHU4
GO termsGO:0006542 glutamine biosynthetic process GO:0006807 nitrogen compound metabolic process GO:0009399 nitrogen fixation GO:0000166 nucleotide binding GO:0003824 catalytic activity GO:0004356 glutamate-ammonia ligase activity GO:0005524 ATP binding GO:0016874 ligase activity GO:0005737 cytoplasm GO:0005515 protein binding GO:0098631 cell adhesion mediator activity
Organisms for which functions have been demonstratedMycobacterium tuberculosis H37Rv (ATCC no. 27294)
Sequence length478 aa
FASTA sequence>tr|A0A0H3LHU4|A0A0H3LHU4_MYCTE Glutamine synthetase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=glnA1 PE=3 SV=1 MTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionGlutamine synthetase ATP + L-glutamate + NH3 => ADP + phosphate + L-glutamine
References for functionHarth, Gunter, Daniel L. Clemens, and Marcus A. Horwitz. "Glutamine synthetase of Mycobacterium tuberculosis: extracellular release and characterization of its enzymatic activity." Proceedings of the National Academy of Sciences 91.20 (1994): 9342-9346.
E.C. number6.3.1.2
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen and fibronectin binding protein
References for functionXolalpa W, Vallecillo AJ, Lara M, MendozaHernandez G, Comini M, Spallek R, Singh M, Espitia C. Identification of novel bacterial plasminogen-binding proteins in the human pathogen Mycobacterium tuberculosis. Proteomics. 2007 Sep;7(18):3332-41. PMID: 17849409
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments