Protein Information

General Information
MoonProt ID67
First appeared in release1.0
Name(s)Histone H1 Histone H1.4 H1 VAR.2 H1e H1f4 Gene Name: Hist1h1e
UniProt IDP43274 (H14_MOUSE), Reviewed
GO termsGO:0006334 nucleosome assembly GO:0016584 nucleosome positioning GO:0003677 DNA binding GO:0005515 protein binding GO:0005515 protein binding GO:0000786 nucleosome GO:0005634 nucleus GO:0005694 chromosome
Organisms for which functions have been demonstratedMus musculus
Sequence length219
FASTA sequence>gi|193865|gb|AAA37814.1| histone H1 [Mus musculus] MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionHistone H1 binds to DNA near nucleosomes aids in condensation of nucleosome chains into higher-order structured fibers
References for functionFan, Yuhong, et al. "Histone H1 depletion in mammals alters global chromatin structure but causes specific changes in gene regulation." Cell 123.7 (2005): 1199-1212.
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments
Function 2
Function descriptionthyroglobulin receptor
References for functionBrix K, Summa W, Lottspeich F, Herzog V. Extracellularly occurring histone H1 mediates the binding of thyroglobulin to the cell surface of mouse macrophages. J Clin Invest. 1998 Jul 15;102(2):283-93. PMID: 9664069
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments