Protein Information

General Information
MoonProt ID83
First appeared in release1.0
Name(s)Peroxiredoxin
UniProt IDA0A125WDU3
GO termsGO:0055114 oxidation-reduction process GO:0004601 peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0051920 peroxiredoxin activity GO:0005515 protein binding
Organisms for which functions have been demonstratedNeisseria meningitidis
Sequence length122 aa
FASTA sequence>tr|A0A125WDU3|A0A125WDU3_NEIME Antioxidant, AhpC/TSA family OS=Neisseria meningitidis NM2795 GN=NMEN2795_0797 PE=4 SV=1 MVMYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFQFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNGEGKMTHEWRKVKVAGHAQEVLETLSR
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionPeroxiredoxin, antioxidant
References for functionRouhier, Nicolas, and Jean-Pierre Jacquot. "Molecular and catalytic properties of a peroxiredoxin–glutaredoxin hybrid from Neisseria meningitidis." FEBS letters 554.1-2 (2003): 149-153.
E.C. number1.11.1.15
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionKnaust A, Weber MV, Hammerschmidt S, Bergmann S, Frosch M, Kurzai O. (2007) Cytosolic proteins contribute to surface plasminogen recruitment of Neisseria meningitidis. J Bacteriol. 189(8):3246-55. PMID: 17307854
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments