Protein Information

General Information
MoonProt ID87
First appeared in release1.0
Name(s)Phosphoglycerate kinase PGK1 Gene Name: PGK1
UniProt IDP46273 (PGK_CANAL), Reviewed
GO termsGO:0006096 glycolysis GO:0016310 phosphorylation GO:0044416 induction by symbiont of host defense response GO:0051701 interaction with host GO:0000166 nucleotide binding GO:0004618 phosphoglycerate kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0016301 kinase activity GO:0016740 transferase activity GO:0005576 extracellular region GO:0005618 cell wall GO:0005737 cytoplasm GO:0005886 plasma membrane GO:0009277 fungal-type cell wall GO:0009897 external side of plasma membrane GO:0009986 cell surface GO:0030446 hyphal cell wall GO:0005515 protein binding
Organisms for which functions have been demonstratedCandida albicans
Sequence length417
FASTA sequence>gi|799385|gb|AAA66523.1| phosphoglycerate kinase [Candida albicans] MSLSNKLSVKDLDVAGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVEEHKPKYIVLASHLGRPNGERNDKYSLAPVATELEKLLGQKVTFLNDCVGPEVTKAVENAKDGEIFLLENLRYHIEEEGSSKDKDGKKVKADPEAVKKFRQELTSLADVYINDAFGTAHRAHSSMVGLEVPQRAAGFLMSKELEYFAKALENPERPFLAILGGAKVSDKIQLIDNLLDKVDMLIVGGGMAFTFKKILNKMPIGDSLFDEAGAKNVEHLVEKAKKNNVELILPVDFVTADKFDKDAKTSSATDAEGIPDNWMGLDCGPKSVELFQQAVAKAKTIVWNGPPGVFEFEKFANGTKSLLDAAVKSAENGNIVIIGGGDTATVAKKYGVVEKLSHVSTGGGASLELLEGKDLPGVVALSNKN
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionPhosphoglycerate kinase, enzyme ADP + 1,3-bisphosphoglycerate => ATP + 3-phospho-D-glycerate Carbohydrate degradation, glycolysis
References for functionAlloush, Habib M., et al. "3-Phosphoglycerate kinase: a glycolytic enzyme protein present in the cell wall of Candida albicans." Microbiology 143.2 (1997): 321-330.
E.C. number2.7.2.3
Location of functional site(s)Binding site:170,39,219,122,343,312 Nucleotide binding site:372-375
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins.Mol Microbiol. 2003 Mar;47(6):1637-51.PMID: 12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments