Protein Information

General Information
MoonProt ID9
First appeared in release1.0
Name(s)6-phosphofructokinase Short name=Phosphofructokinase Alternative name(s): Phosphohexokinase Gene Name:pfkA
UniProt IDP0DOB5
GO termsGO:0006002 fructose 6-phosphate metabolic process GO:0006096 glycolysis GO:0016310 phosphorylation GO:0008152 metabolic process GO:0046835 carbohydrate phosphorylation GO:0000166 nucleotide binding GO:0003824 catalytic activity GO:0003872 6-phosphofructokinase activity GO:0005524 ATP binding GO:0008443 phosphofructokinase activity GO:0016301 kinase activity GO:0016740 transferase activity GO:0046872 metal ion binding GO:0005737 cytoplasm GO:0005945 6-phosphofructokinase complex GO: 0005515 protein binding
Organisms for which functions have been demonstratedLactococcus lactis IL1403
Sequence length340
FASTA sequence>sp|P0DOB5|PFKA_LACLA ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pfkA PE=3 SV=1 MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDKIGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNAGIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYKGDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGTAEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
Structure Information
PDB IDclosest homolog with structure in PDB is Bacillus sterothermophilus at 66% amino acid sequence identity
Quaternary structure
Function 1
Function description6-phosphofructokinase, enzyme ATP + D-fructose 6-phosphate => ADP + D-fructose 1,6-bisphosphate Carbohydrate degradation, glycolysis
References for functionRamos, A. N. A., et al. "Relationship between glycolysis and exopolysaccharide biosynthesis in Lactococcus lactis." Applied and environmental microbiology 67.1 (2001): 33-41.
E.C. number2.7.1.11
Location of functional site(s)Active site:127 Binding site:154,162,211,244,11,222 Metal binding site:103 Nucleotide binding site:72-73,102-105
Cellular location of functionCytoplasm
Comments
Function 2
Function descriptionbinding to invertase, a hyperglycosylated mannoprotein from Saccharomyces cerevisiae
References for functionKatakura Y, Sano R, Hashimoto T, Ninomiya K, Shioya S. 2010. Lactic acid bacteria display on the cell surface cytosolic proteins that recognize yeast mannan. Appl. Microbiol. Biotechnol. 86:319 326. PMID: 19898842
E.C. numberN/A
Location of functional site(s)
Cellular location of functionCell surface
CommentsInvolved in symbiotic relationship between lactic acid bacteria (LAB) and yeast. LAB break down starch and other carbohydrates and provide lactic acid to yeast while receiving some nutrients from the yeast. This bacteria and yeast symbiosis is found in some fermented foods like kefir, a type of fermented milk.