Protein Information

General Information
MoonProt ID91
First appeared in release1.0
Name(s)Phosphoglyceromutase GPM1 Phosphoglycerate mutase PGAM BPG-dependent PGAM MPGM Gene Name: GPM1
UniProt IDP82612 (PMGY_CANAL), Reviewed
GO termsGO:0006096 glycolysis GO:0008150 biological_process GO:0008152 metabolic process GO:0051701 interaction with host GO:0003674 molecular_function GO:0003824 catalytic activity GO:0004619 phosphoglycerate mutase activity GO:0005515 protein binding GO:0016853 isomerase activity GO:0016868 intramolecular transferase activity, phosphotransferases GO:0005575 cellular_component GO:0005737 cytoplasm GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0030446 hyphal cell wall GO:0005515 protein binding
Organisms for which functions have been demonstratedCandida albicans
Sequence length248
FASTA sequence>gi|229463024|sp|P82612.3|PMGY_CANAL RecName: Full=Phosphoglycerate mutase; Short=PGAM; AltName: Full=BPG-dependent PGAM; AltName: Full=MPGM; AltName: Full=Phosphoglyceromutase MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGINVDVLHTSKLSRAIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLEAYGQEKFQIWRRSFDVPPPKIDPKDEYSQVGDRRYADVDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAAVAAQGQKK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionPhosphoglyceromutase, enzyme 1,3-bisphosphoglycerate <=> 2,3-bisphosphoglycerate Carbohydrate degradation, glycolysis
References for functionJong, Ambrose Y., et al. "Binding of Candida albicans enolase to plasmin (ogen) results in enhanced invasion of human brain microvascular endothelial cells." Journal of medical microbiology52.8 (2003): 615-622.
E.C. number5.4.2.1
Location of functional site(s)Active site:87,9 Binding site:98,60 Other functional site:182
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments