Protein Information

General Information
MoonProt ID95
First appeared in release1.0
Name(s)Transcription elongation factor TEF1 Elongation factor 1-alpha 1 EF-1-alpha 1 Gene Name: TEF1
UniProt IDP0CY35 (EF1A1_CANAL), Reviewed
GO termsGO:0006184 GTP catabolic process GO:0006412 translation GO:0006414 translational elongation GO:0005515 protein binding GO:0006415 translational termination GO:0051701 interaction with host GO:0000166 nucleotide binding GO:0003746 translation elongation factor activity GO:0003747 translation release factor activity GO:0003924 GTPase activity GO:0005515 protein binding GO:0005525 GTP binding GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0022626 cytosolic ribosome GO:0030445 yeast-form cell wall GO:0030446 hyphal cell wall
Organisms for which functions have been demonstratedCandida albicans
Sequence length458
FASTA sequence>sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSVKWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEPSTNCPWYKGWEKETKSGKVTGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKGCDSFNAQVIVLNHPGQISAGYSPVLDCHTAHIACKFDTLVEKIDRRTGKKLEENPKFVKSGDAAIVKMVPTKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAGKVTKAAQKAAKK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionTranscription elongation factor during protein biosynthesis, TEF1 promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of the ribosome
References for functionPonting, Chris P. "Novel domains and orthologues of eukaryotic transcription elongation factors." Nucleic acids research 30.17 (2002): 3643-3652.
E.C. numberN/A
Location of functional site(s)Nucleotide binding site:14-21,91-95,153-156
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments