Protein Information

General Information
MoonProt ID97
First appeared in release1.0
Name(s)Thiol-specific antioxidant protein TSA1 Peroxiredoxin TSA1 Thioredoxin peroxidase Gene Name: TSA1
UniProt IDQ9Y7F0 (TSA1_CANAL), Reviewed
GO termsGO:0030447 filamentous growth GO:0031505 fungal-type cell wall organization GO:0034599 cellular response to oxidative stress GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation GO:0036171 filamentous growth of a population of unicellular organisms in response to chemical stimulus GO:0042542 response to hydrogen peroxide GO:0042744 hydrogen peroxide catabolic process GO:0051701 interaction with host GO:0055114 oxidation-reduction process GO:0070301 cellular response to hydrogen peroxide GO:0004601 peroxidase activity GO:0005515 protein binding GO:0008379 thioredoxin peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0030985 high molecular weight kininogen binding GO:0051920 peroxiredoxin activity GO:0005634 nucleus GO:0005737 cytoplasm GO:0030446 hyphal cell wall GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0005515 protein binding
Organisms for which functions have been demonstratedCandida albicans
Sequence length196
FASTA sequence>sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1 MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionThiol-specific antioxidant protein antioxidant 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
References for function
E.C. numberN/A
Location of functional site(s)Active site:48 Binding site:124
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments